CAZyme Information: MGYG000003347_00379

Basic Information

• Species: Prevotella sp900765465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900765465
• CAZyme ID: MGYG000003347_00379
• CAZy Family: GH51
• CAZyme Description: Extracellular exo-alpha-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000003347_94|CGC1	38997.14	5.2782

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003347	2095533	MAG	China	Asia

• Gene Location: Start: 31; End: 1092 Strand: +

Full Sequence      

MGSLDAALGEAVYMMGIENNSDIVTMASYAPIFANLNNRMWAPDMIQYTSDKVFGTPSYY
VQNVMANNIGTRVLKVNQENPYKYEQTQVKPAICRVGMGTWGTQVSFEDKGYSDENGKAL
PMTMQELPTDIHGQWKTEGSLIKQTSNEESCIRLNPGEITSNGYIYKVRAKKDAGNEGFL
IIFNYVDKNNYCWLNLGGWNNTQHGVESIVNGAKSQVATCPGKIETGKWYDIELKVVGDS
IFAKLDGKEVFATKLKANTLPGIFSTATLDEQTGEVILKIANTSTEHTTAKINLQGKEIK
DGKLIRLSAKNGLEENTIDNPTNIYPVENYVTTEKNGATVEIPASSLNIIRLK

Enzyme Prediction     

No EC number prediction in MGYG000003347_00379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	3	353	8.2e-32	0.42063492063492064

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06964	Alpha-L-AF_C	2.71e-20	3	81	23	95	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	8.29e-20	2	81	18	92	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66893.1	6.73e-250	1	353	461	813
AGB28822.1	1.30e-128	1	353	454	805
BCS85815.1	1.42e-128	2	353	442	795
ADE81175.1	6.65e-102	1	353	489	827
AGB28798.1	1.18e-83	2	352	459	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	7.32e-12	3	74	453	524	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	6.96e-47	8	353	479	823	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q8VZR2	3.56e-17	2	74	475	547	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
Q9SG80	4.79e-17	2	74	476	548	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8NK90	9.38e-13	3	82	459	540	Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=abfA PE=1 SV=2
Q96X54	9.38e-13	3	82	459	540	Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori OX=105351 GN=abfA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003347_00379.