CAZyme Information: MGYG000003348_00896

Basic Information

• Species: Dialister sp900765565
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900765565
• CAZyme ID: MGYG000003348_00896
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		38021.67	7.4829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003348	2475189	MAG	China	Asia

• Gene Location: Start: 2063; End: 3046 Strand: -

Full Sequence      

MSNVLSHAITETIHFGRKPEKGDFHIALTGTADYIPHMGVVALTVHAHNEDMPICYHFFV
NHLEDVERKRLEEAADIMESPLEVHIIDDSAFKTLLLTDGVAAFFYRFLVAPAIAPVADR
VLYLDGDMMCRGSLKYLRDLDFQGNDVAVVSDRKEELQMKRVHTKRYFNAGMMLINVKQW
MEENRFDEIVHRAEENVKRVGNRLSHHDQDIHNEMLDGKCLYLEKKYNYLYNLDRQSLFK
KQPVNEDYKKQVIIHFAGHAKPWHSWVQDWPVVKEYAAIQKASPWKDVPLVPPKGHKNLH
QAARTARMRGKYGEMIGYYVKYLGDKV

Enzyme Prediction     

No EC number prediction in MGYG000003348_00896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	23	266	2.7e-44	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15171	PRK15171	2.06e-57	9	327	9	333	lipopolysaccharide 3-alpha-galactosyltransferase.
cd04194	GT8_A4GalT_like	8.03e-55	24	265	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	7.87e-44	25	266	1	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	1.97e-41	24	301	3	280	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam08437	Glyco_transf_8C	2.60e-17	271	324	1	54	Glycosyl transferase family 8 C-terminal. This domain is found at the C-terminus of the pfam01501 domain in bacterial glucosyltransferase and galactosyltransferase proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25792.1	3.56e-189	1	327	1	327
BBK25902.1	6.04e-84	17	326	19	336
QIB60889.1	4.07e-48	33	327	31	318
AIF53734.1	2.82e-45	5	322	3	314
AIF53733.1	1.04e-44	16	327	19	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SS9_A	1.25e-13	26	264	3	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	2.28e-13	26	264	3	253	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
6U4B_A	9.87e-08	106	265	387	570	ChainA, WbbM protein [Klebsiella pneumoniae]
3TZT_A	1.58e-07	26	263	8	252	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
5GVV_A	2.47e-07	119	264	100	236	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27128	1.53e-40	39	327	44	337	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19816	4.22e-39	14	327	18	335	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27129	1.37e-25	25	287	29	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19817	3.85e-21	33	289	35	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P25148	1.53e-15	25	288	8	279	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003348_00896.