CAZyme Information: MGYG000003348_01570

Basic Information

• Species: Dialister sp900765565
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900765565
• CAZyme ID: MGYG000003348_01570
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	MGYG000003348_231|CGC1	59622.4	9.0412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003348	2475189	MAG	China	Asia

• Gene Location: Start: 5694; End: 7292 Strand: +

Full Sequence      

MKINKNCLFLFLFCLVLYGAGVGLIPLLDPDEPVYGETAKEMIATGDWISPRIYGDFWYD
KPPLFYWLEAVSFSIFGVSTWAARLPSVLLGALTPVYLYLSSRRLIGEKAALRGAFICAS
SLEIIVLARSSVTDTLLTFTLTVALLSFLRKDYVIAYIACGLALLTKGPIGFGFPAFIVG
LWMIFTKRFTLENVMALKWYWGIPLACLVGLPWYIDMAMIHGNAFIDTFLGYHNITRFVS
PEHAGQNHYWLYLVVVLVGFYPWVGTLPGLLRRVKTWMKDRNASYFLVWALFIFLFFSFS
STQLFSYILPLFPPLSLLAGMYVTDSEKSGRISKTFLLCHVIFGLLIAGAIAFVPFIPAG
GPAVRYGVALFMAAISLLAAERLKSGRIHGFFVSQALLMVGFVLSIWCLFAGPVSSLFTS
KAIAEELARTKTDSSIPLYIDTFYRPSIAFYTDIYGKALPEFDKKKLSVDEKNAENGVLL
PGKDEETSLPPKAYILVQDKVYNKWPKDQKQGLTVLWKKDTASLYLKDEVSQ

Enzyme Prediction     

No EC number prediction in MGYG000003348_01570.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	453	1e-114	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.27e-35	20	456	23	477	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.13e-21	24	290	20	300	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.23e-15	60	188	1	134	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	6.95e-11	31	215	24	232	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	3.45e-04	26	129	36	132	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24580.1	1.12e-280	1	527	1	527
AOH39317.1	1.43e-205	4	530	6	530
AVO73979.1	2.73e-105	22	509	26	497
CCC72524.1	2.73e-105	22	509	26	497
AVO26796.1	2.73e-105	22	509	26	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.18e-30	15	321	42	362	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KGY4	1.20e-34	12	358	10	367	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
B2VBI7	3.23e-34	1	354	1	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
C5BDQ8	1.09e-33	27	345	27	355	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B4EUL1	1.94e-33	8	353	12	365	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
A4SQX1	3.54e-33	1	352	1	361	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000008	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
80	102
111	133
153	186
199	221
249	271
283	300
304	323
336	358
363	380
392	414