CAZyme Information: MGYG000003351_01362

Basic Information

• Species: Bacteroides sp900765785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900765785
• CAZyme ID: MGYG000003351_01362
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		71105.68	5.0354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003351	6569749	MAG	China	Asia

• Gene Location: Start: 11318; End: 13198 Strand: -

Full Sequence      

MKKHSTLVAAILAISGSLTGCQEVKSPEPVLPIPQEKQVNWQKMETYAFVHFGLNTFNDR
EWGYGDSDPKTFNPARLDCEQWVQTFVNSGMKGVILTAKHHDGFCLWPTQLTEYCIRNTP
YKDGKGDIVRELSDACKKYGIKFAVYLSPWDRHQANYGTPEYVDYFYKQLHELLTNYGDV
FEIWFDGANGGDGWYGGAKDARTIDRKTYYDYPRAYKMIDELQPQAVIFSDGGPGCRWVG
NESGFAGATNWSFLRAGEVYPGYPKYRELQYGHADGNQWVAAECDVSIRPGWFYHPEEDN
RVKTVDQLTDLYYRSVGHNGTLLLNFPVDRNGLIHPTDSLNAVTFHQRVQKELADNLLSK
AKVSASDERGGQFNVRALTDGQYDTYWATNDSVMAADLTFTFEQPTKMNRVMIQEYIPLG
QRVKSFVVEYKKGDQWLPVKCNEETTTVGYKRLLRFETIETEQLRIRFTDARACLCINEA
GAYYAPDATESYTSATSELRSFPFTIVGVNEEEVKKCSDKDDQTTAFIPGKEIVIDLSES
RTLHSFYYLPDQSEYSKGLISSYELSAGPTEETMQVIAKGEFSNIRNNPILQSVYFSPVE
ARFLKLKATRMVDESDSLGLAEVGCQ

Enzyme Prediction     

No EC number prediction in MGYG000003351_01362.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	34	338	7.8e-82	0.8323699421965318

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	2.95e-61	25	483	2	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	6.42e-43	61	336	69	315	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.27e-38	49	334	31	315	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	6.17e-12	362	470	1	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam14871	GHL6	4.35e-04	78	153	1	74	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT70355.1	0.0	3	626	2	627
ALJ42808.1	0.0	5	626	11	627
QMW87016.1	0.0	5	626	11	627
QUT42721.1	0.0	5	626	11	627
QQA07177.1	0.0	5	626	11	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	6.50e-176	28	611	33	570	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	2.70e-133	22	609	22	566	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3EYP_A	2.11e-121	33	483	9	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	5.34e-115	34	482	19	475	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	6.57e-113	34	482	19	475	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	6.23e-115	27	483	31	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.66e-111	27	514	33	500	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q9BTY2	2.07e-10	41	421	78	407	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q5RFI5	1.47e-09	41	421	76	405	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
P17164	1.37e-08	40	336	76	345	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003351_01362.