CAZyme Information: MGYG000003351_03280

Basic Information

• Species: Bacteroides sp900765785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900765785
• CAZyme ID: MGYG000003351_03280
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	MGYG000003351_405|CGC1	89137.06	7.6341

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003351	6569749	MAG	China	Asia

• Gene Location: Start: 19835; End: 22162 Strand: +

Full Sequence      

MKKSISLLFLLVSIICSAQGKGFILRSGKQVTLGCDLREEQVVHTALELLSRDCQTVLSS
SLKIKDKGGDLIVGTLGRSNLINKVGIDLAELEGKKQAFLLAVNPKGKLVIAGSDSHGTA
YGVMELSRLMGVSPWEWWADATPDRKETFELPANFRTAQAPSVEYRGIFINDEDWGLLPW
SNKTYEPSEVKGHIGPRTNERIFELLLRLRANTYWPAMHECTLPFFMTEGNKEAAAKYGI
FIGSSHCEPMVCNAAGEWNRRGEGAYNYVTNRDNVYKFWEERVKDVARQNNIYTLGMRGV
HDGSMQGARTREEQKAVLKRVIEEQRGLLEKYVNKDVRRVPQVFIPYKEVLDIYNAGLQV
PDDVTLMWCDDNYGYIRHFPTEEERLRKGGNGVYYHISYWGRPHDYLWLATTSPALVYQQ
MKLAFDKGIQKMWILNVGDIKPAEYLIELYMDMAWNLDAVADEGLDAHLCKFLKREFGGE
IADSLLPVMKEYYRLAYIRKPEFMGNTREEDKSHYRIIKDLPWSESYIRERLNLYQELSD
RVEAIAGGIPERKQDTYFQLIKYPVQASDQMNQKLLKAQLARHGKADWKESDMAYDSIVA
LTRIYNNEKWNRIMDFRPRRLPVFERVKRGAVAEPMVAERKVLYKWNGAECNQGVPVIYD
GLGYERKAVGIKKGQDLHFCFDDCDTDSIEVEVRMLPNHPVNADRLRIAISLDGGEPAVL
SYETVGRSEEWKENVLRNQAIRRVTFPVNRGTKHQLVLRALDEGVVLDQIYLFRR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	26	770	4.5e-235	0.9885222381635581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	159	503	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.77e-17	686	770	67	156	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ54676.1	0.0	3	773	4	780
ALJ47783.1	0.0	3	773	4	780
BCA52290.1	0.0	12	773	13	780
QUT73086.1	0.0	12	773	13	780
QIU93282.1	0.0	6	773	11	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	0.0	21	773	18	774	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4ZMH_A	4.84e-95	63	611	59	607	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	5.36e-93	71	614	96	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	1.08e-89	24	614	18	624	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	2.11e-89	24	614	19	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000201	0.999222	0.000160	0.000140	0.000135	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003351_03280.