CAZyme Information: MGYG000003351_03286

Basic Information

• Species: Bacteroides sp900765785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900765785
• CAZyme ID: MGYG000003351_03286
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
713	MGYG000003351_405|CGC1	81338.42	5.5008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003351	6569749	MAG	China	Asia

• Gene Location: Start: 31492; End: 33633 Strand: +

Full Sequence      

MKHKLFLKLACIVMLSSCNSTKVAPPQPYGALPTERQLAWHEMEMYNMIEFNQNNALDIH
WGWGNESPELVNPVDFDAEEIVLLAKKIGSKGFLINAKHHGGFCMWPTKTTDYNISRSPW
KNGKGDWVGEWAEACRKHGLKLGLYLSPWDRNAACFGTPEYLKMYKEQLTELCTNYGELF
TLWFDGAPGSGGSGYYGGANEYRGGFIEYYDWENIYAIVRELQPNAVIFNDPGPDIRWVG
NEDGYAGRYNKTCWATLFPEGNWNMRPRPNSDGERIKMLNEGQRNGKYWIPAECDFSLKS
RFAYHTTDSLTTKSPQKLFDIYLASVGLGQGFDMCLPLTPKGVMEWRDVKSLEAFADLMD
KTFSENLIKGAHLMPSNVRGNATKYYGTAKLIDNDRYSYWATDDSVTNASVIIELPKKQD
FNLVKVRENIKLGQRLDSMKVDNWVDGEWKEVAEATSVGACRIIRLDNDLDTDKIRIRFF
APVALAISEVSLFKEPENLEMPKISRTKDGMVTIKTDRPAFAIRYTTDGSEPLFTSQEYE
APFLFDKQGVIRSAVFTSEKTHGEIASITFDQCKKDWKIISPTKSGVNNMIDDNVESYFH
TYDANNQNKFVPDEIIVDMGAVIPVFEIIYTPRQDMHRNVDGVIETYEVYLSENRVKWDL
VSTGTFQNIRQSLVPQEIKLMKPYPSRYLKLVVTSVLEKNFMSIAEIGVRTSE

Enzyme Prediction     

No EC number prediction in MGYG000003351_03286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	36	361	3.4e-61	0.791907514450867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	6.90e-39	26	493	4	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	1.25e-26	72	240	77	237	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	1.82e-26	72	241	80	239	Alpha-L-fucosidase.
pfam13287	Fn3_assoc	4.86e-13	512	570	1	59	Fn3 associated.
pfam00754	F5_F8_type_C	7.97e-10	586	707	13	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM99834.1	0.0	1	711	1	711
CBK67070.1	0.0	25	711	3	689
QRO23414.1	2.65e-302	1	709	1	716
AOW10315.1	2.49e-213	1	711	1	703
QEM09813.1	2.59e-210	4	709	2	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	2.67e-97	24	464	30	434	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	2.03e-87	32	478	31	442	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	3.18e-81	33	468	19	451	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3EYP_A	1.86e-80	28	478	5	438	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UET_A	3.46e-79	33	468	19	451	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.06e-96	6	477	11	460	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	2.62e-79	19	465	26	448	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000089	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003351_03286.