CAZyme Information: MGYG000003353_00932

Basic Information

• Species: Prevotella corporis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella corporis
• CAZyme ID: MGYG000003353_00932
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		58935.32	4.8916

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003353	2741974	MAG	China	Asia

• Gene Location: Start: 5580; End: 7157 Strand: -

Full Sequence      

MLGTTWRQLDNYRNLMDIRKKIDCFLPCNDLQRAATIAEQFQHNDTVNQIYLLVSGKATT
SKGLPEGVSTIAVDNLLSADTMRAMAEASTADYALFYMKSTPVTLGYQAIDRFMQVASAT
DAMLVYADHYSVEDGQTVKHPVIDYQAGSIRDDFDFGSLVLIDGGALKAYAKLAVEAQYM
FAGWYDLRLFLSRMGQVFHLNEYLYTEEEDDLRASGEKQFDYVNPRNREVQIEMEKAATA
HLEAVGALVDTANYAQPDFEGGNFGVEATVVIPVFNREKTIRDAVESALKQKTDFKYNVI
VVDNHSSDKTTEILARLADNDKRLIHLVPNRHDLGIGGCWNYAVNNENCGRFAVQLDSDD
LYSSENTLQKVVDAFHEQKAAMIIGSYRMCDFELNTLPPGLIDHAEWTDENGCNNALRIN
GLGAPRAFYTPLARAVRFPNTSYGEDYAVGLAFSRCYRIGRIYDELYLCRRWGGNSDAAL
SIEKVNANNLYKDRIRTIELSARKALNKCGDKEGATRLEPFFTVS

Enzyme Prediction     

No EC number prediction in MGYG000003353_00932.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	269	401	3.6e-23	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	7.22e-21	269	438	1	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.67e-20	270	390	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	1.89e-18	269	475	6	201	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04179	DPM_DPG-synthase_like	2.01e-16	270	389	1	118	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd06423	CESA_like	5.30e-15	270	398	1	127	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATV53621.1	9.31e-288	16	525	1	510
QUB48312.1	1.88e-287	16	525	1	510
BAU17285.1	5.37e-287	16	525	1	510
APW34203.1	5.37e-287	16	525	1	510
BAR96143.1	5.37e-287	16	525	1	510

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57022	8.53e-07	269	397	7	131	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003353_00932.