CAZyme Information: MGYG000003353_01173

Basic Information

• Species: Prevotella corporis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella corporis
• CAZyme ID: MGYG000003353_01173
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		41834.85	9.2669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003353	2741974	MAG	China	Asia

• Gene Location: Start: 356; End: 1459 Strand: -

Full Sequence      

MKVKSLLFVGVSFLAFPYQTMAQFYTIMRESESAKRAVKNDESGKNKVDEDYFYAYQDSM
RVHSKESETKTDFSDFFSTAEGHEISIEKDVPIFVNVKDSLLFGLIKQRMDVCLPLDFIS
VTSQYGYRKDPFKKCSAFHDGIDLECNMKHVYSMLPGRVLKVVYSKKGYGNHVILDYGHI
QCLYGHLSVIAVRQGDEVYAGTIVGISGSTGKSTGPHLHIKITANGKSLNPTPFIAYLNK
YITGLRDKIAYVRFGKRPPKELNINNLYQALDKYGIVFPKIVVAQALLETGYFTSNVCLN
YNNLFGLRRPSDGSYYRFGNWEESVKAYKDYVQYKYRGGDYFRFLGQIGYAEDPNYLYKV
KSISSSL

Enzyme Prediction     

No EC number prediction in MGYG000003353_01173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	269	364	5.5e-16	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0739	NlpD	2.86e-27	114	251	138	277	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].
pfam01551	Peptidase_M23	9.56e-27	138	231	2	96	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
cd12797	M23_peptidase	9.38e-24	139	222	1	85	M23 family metallopeptidase, also known as beta-lytic metallopeptidase, and similar proteins. This model describes the metallopeptidase M23 family, which includes beta-lytic metallopeptidase and lysostaphin. Members of this family are zinc endopeptidases that lyse bacterial cell wall peptidoglycans; they cleave either the N-acylmuramoyl-Ala bond between the cell wall peptidoglycan and the cross-linking peptide (e.g. beta-lytic endopeptidase) or a bond within the cross-linking peptide (e.g. stapholysin, and lysostaphin). Beta-lytic metallopeptidase, formerly known as beta-lytic protease, has a preference for cleavage of Gly-X bonds and favors hydrophobic or apolar residues on either side. It inhibits growth of sensitive organisms and may potentially serve as an antimicrobial agent. Lysostaphin, produced by Staphylococcus genus, cleaves pentaglycine cross-bridges of cell wall peptidoglycan, acting as autolysins to maintain cell wall metabolism or as toxins and weapons against competing strains. Staphylolysin (also known as LasA) is implicated in a range of processes related to Pseudomonas virulence, including stimulating shedding of the ectodomain of cell surface heparan sulphate proteoglycan syndecan-1, and elastin degradation in connective tissue. Its active site is less constricted and contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules, possibly contributing to its activity against a wider range of substrates than those used by related lytic enzymes, consistent with its multiple roles in Pseudomonas virulence. The family includes members that do not appear to have the conserved zinc-binding site and might be lipoproteins lacking proteolytic activity.
pfam01832	Glucosaminidase	3.18e-13	268	333	5	80	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	3.08e-12	269	363	21	135	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATV39431.1	4.71e-219	1	367	1	368
QUB71734.1	2.16e-143	77	367	63	353
QUB53548.1	5.22e-141	77	367	60	350
QUI93470.1	5.22e-141	77	367	60	350
QUB51704.1	5.22e-141	77	367	60	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JMX_A	1.06e-15	121	239	131	250	ChainA, Peptidase M23 [Campylobacter jejuni],6JMY_A Chain A, Peptidase M23 [Campylobacter jejuni],6KV1_A Chain A, Peptidase M23 [Campylobacter jejuni]
3SLU_A	1.29e-15	115	231	222	338	Crystalstructure of NMB0315 [Neisseria meningitidis ATCC 13091],3SLU_B Crystal structure of NMB0315 [Neisseria meningitidis ATCC 13091]
6MUK_A	1.54e-15	115	231	242	358	1.93Angstrom Resolution Crystal Structure of Peptidase M23 from Neisseria gonorrhoeae. [Neisseria gonorrhoeae FA 1090]
6JN1_A	2.05e-14	121	239	131	250	ChainA, Peptidase M23 [Campylobacter jejuni]
6JN0_A	2.08e-14	121	239	131	250	ChainA, Peptidase M23 [Campylobacter jejuni],7E60_A Chain A, Peptidase M23 [Campylobacter jejuni],7E61_A Chain A, Peptidase M23 [Campylobacter jejuni],7E63_A Chain A, Peptidase M23 [Campylobacter jejuni],7E63_B Chain B, Peptidase M23 [Campylobacter jejuni],7E64_A Chain A, Peptidase M23 [Campylobacter jejuni],7E65_A Chain A, Peptidase M23 [Campylobacter jejuni],7E65_B Chain B, Peptidase M23 [Campylobacter jejuni],7E66_A Chain A, Peptidase M23 [Campylobacter jejuni],7E67_A Chain A, Peptidase M23 [Campylobacter jejuni],7E69_A Chain A, Peptidase M23 [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44693	3.74e-11	139	231	348	442	Uncharacterized metalloprotease HI_0409 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0409 PE=3 SV=1
O05156	3.64e-10	125	235	136	253	Glycyl-glycine endopeptidase ALE-1 OS=Staphylococcus capitis OX=29388 PE=1 SV=1
P10548	3.77e-10	125	235	252	369	Lysostaphin OS=Staphylococcus staphylolyticus OX=1287 GN=lss PE=3 SV=1
P10547	3.86e-10	125	235	265	382	Lysostaphin OS=Staphylococcus simulans OX=1286 GN=lss PE=1 SV=2
O31976	1.94e-09	121	250	1564	1686	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000913	0.998189	0.000275	0.000196	0.000198	0.000190

TMHMM  Annotations     

start	end
5	27