CAZyme Information: MGYG000003355_00891

Basic Information

• Species: Lachnoclostridium phytofermentans_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium phytofermentans_A
• CAZyme ID: MGYG000003355_00891
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000003355_39|CGC3	42203.2	4.9696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003355	5194070	MAG	China	Asia

• Gene Location: Start: 73455; End: 74558 Strand: -

Full Sequence      

MKKKTEYLSIIELVEENLNTFLYSTDERYEKNLVEELGRTPAEAKSLASWDWTHGVGIYG
MYKLYQFTNDEKHLDLIETWLNSRIEIGLPIKNVNTVAPLLTMACLYEIRPNEQYKKIMC
EWAEWIMNDMKRTEEGGIQHCHAELENNQELWDDTLFMTVLFLAKAGTIFNRQDYIEEAI
YQFLIHTKYLIDPATGLWFHGWTFIERNNFANALWGRGNCWATIFIPEFLEIVNMSPAFK
RYAINALVGQAKALKKYQAPSGLWHTLIDDENSYLEASGTAGFCYGILKGVRKGYLDSSY
LECGKRALEAILTNIDKNGELMQVSYGTNVGRNLDHYRQIPLSKMHYGQSLAMLALIEGL
ECGGDGE

Enzyme Prediction     

No EC number prediction in MGYG000003355_00891.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	44	358	1.1e-106	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.60e-106	40	360	24	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.23e-100	50	358	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACM35596.1	1.61e-128	10	360	19	370
QPG25852.1	3.83e-128	10	360	24	375
BCH65045.1	1.31e-127	4	360	16	370
QEY12593.1	1.51e-127	43	358	45	362
QCA04773.1	2.19e-127	10	360	24	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	4.10e-114	4	360	23	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	6.85e-113	43	360	59	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.67e-105	43	358	40	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	2.03e-26	50	312	23	299	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.73e-23	50	358	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	5.17e-62	49	361	28	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	2.59e-22	50	358	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003355_00891.