CAZyme Information: MGYG000003355_02994

Basic Information

• Species: Lachnoclostridium phytofermentans_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium phytofermentans_A
• CAZyme ID: MGYG000003355_02994
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000003355_120|CGC3	57288	5.3682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003355	5194070	MAG	China	Asia

• Gene Location: Start: 76203; End: 77759 Strand: -

Full Sequence      

MNLSIRGKVGQRIVAGFPGTAIDSELEDFIRNYKIGNFILFKHNIVNANQLKTLCDGLSK
LSKKYTGHSAFITIDQEGGMVTRLSDDSVNIPGAMALAATKDEKNIYEAGKITGEQLRTL
GFNFNLAPVADINSNMDNPVIGVRSYGDEPNQVAKYSVAMMKGLLDGGVLASAKHFPGHG
DTNVDSHLGLPQVHKSFEEMRQCELVPFEALIEAGIPAIMTSHIIFPALEENHLPATMSK
KIITGLLKETLGFKGLVISDCMEMSAIKKYYGSIEGIKHAIMAGVDLIFVSHTMSVVREA
SDVLTSMLEKGELSMEEMDESIQKIMYYKDKYLGNVDESIDNKEFDVSTGIEFAKELLRK
SITPIQMPDEKLPMVNQNSLFLGCLPIRATNVSNTEEGTFHFADYMAKQFQGKGILTSPQ
PTFEELNSLLQPMKEAEAVVIATYNAHLYKEQLELVKLAAQSNANVIVFALRNPYDLREL
PANVYGIAVYEYTVKSLEALAEYMKHPYELSGKLPVKM

Enzyme Prediction     

No EC number prediction in MGYG000003355_02994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	66	289	1.5e-62	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	4.02e-88	3	363	1	339	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.11e-83	4	325	1	313	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	6.56e-53	19	321	10	319	beta-hexosaminidase; Provisional
PRK15098	PRK15098	8.81e-15	92	374	121	407	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX41503.1	3.70e-301	1	518	1	517
QUH30605.1	6.11e-219	1	518	1	514
QJD88473.1	1.09e-149	13	513	1	498
AUS97055.1	1.91e-145	1	518	1	518
QHX43084.1	1.75e-141	9	505	10	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.01e-92	3	518	11	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.13e-86	8	518	12	527	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	1.84e-65	2	490	41	581	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.92e-65	2	490	15	555	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.07e-64	2	490	45	585	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.01e-64	2	490	41	581	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.32e-54	20	516	49	594	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A1KSD9	5.41e-35	13	299	11	297	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) OX=272831 GN=nagZ PE=3 SV=1
Q5FA94	7.46e-35	13	305	11	303	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1
Q9K0Q4	7.46e-35	13	299	11	297	Beta-hexosaminidase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003355_02994.