CAZyme Information: MGYG000003356_00318

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Lancefieldella
• CAZyme ID: MGYG000003356_00318
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		36258.01	5.8806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003356	1207795	MAG	China	Asia

• Gene Location: Start: 61; End: 1002 Strand: +

Full Sequence      

MTQYFFFTQWAKVKSYANKRGVLIIGDLPIYVSRDSVEMWAQPELFKTDETGRPVTVAGT
PADQFSSTGQYWGNPIYNWEYMKKSHYSWWVWRVQTNLEMFDVLRIDHFRCFEAYWEIPY
GAANATEGKWTKGPDLELFKELEKQLGKLPIIAEDLGLITPELIAMRDKTGFPGMKILQY
GFDGKHDSRDLPHNYTANTIAYVGTHDNPTARGWYETQATDREREQADIYLHRSKDEPIG
EALSRGIAASVSDTCIHTMQDLLGLDDSARMNVPATVGGNWCWRMKQGAITRHIEDFLRT
ITEMYFRVYKEEK

Enzyme Prediction     

No EC number prediction in MGYG000003356_00318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	2	304	6e-109	0.6194331983805668

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	6.25e-170	2	307	192	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	1.86e-145	3	286	179	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	3.10e-121	2	285	218	500	disproportionating enzyme
COG1640	MalQ	1.27e-108	3	307	205	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	2.05e-94	3	307	207	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV51038.1	9.67e-224	1	313	185	497
AKT47809.1	1.40e-157	1	308	184	491
AZH70365.1	3.05e-149	1	313	185	496
ATP54274.1	1.23e-148	1	311	185	494
AFA54836.1	9.99e-148	1	311	185	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M6T_A	3.78e-111	1	312	190	501	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
2X1I_A	1.34e-95	2	308	188	500	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1FP8_A	3.79e-95	2	303	188	495	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
1CWY_A	3.79e-95	2	303	188	495	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]
2OWC_A	8.97e-94	2	303	191	497	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3Q1	1.47e-115	1	308	189	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	1.47e-115	1	308	189	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
Q59266	1.67e-107	3	307	180	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
O87172	2.08e-94	2	303	188	495	4-alpha-glucanotransferase OS=Thermus thermophilus OX=274 GN=malQ PE=1 SV=1
P72785	3.78e-93	3	307	193	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003356_00318.