CAZyme Information: MGYG000003357_00409

Basic Information

• Species: Streptococcus alactolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus alactolyticus
• CAZyme ID: MGYG000003357_00409
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000003357_18|CGC2	34269.49	5.1449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003357	1593339	MAG	China	Asia

• Gene Location: Start: 28499; End: 29419 Strand: +

Full Sequence      

MEKRSHRHRRQKKKPTVLIWFFLAFACVIAGVAIFFIAKPNHATKQAQDVIKQESTVIAV
SSTSSSTTSQESSEVDWVKQDTAIHFPILMYHAIHVMAPEESANANLIVDPTTFESHIQR
LSNEGYYFLTPEEVHKVLTENVLPNGNQKIIWLTFDDSLWDFYDNAYPILQKYQVKATNN
VITSTVGSQANLSLDEMLEMKNNGMSFQDHTVTHPDLSATDSSTQTTEMKDSKQYLDDSL
NQDTIAIAYPAGRYSDTTLQIAENLDYKLGVTTNEGLASADNGLLSLNRIRILPTTTADS
IMATIN

Enzyme Prediction     

No EC number prediction in MGYG000003357_00409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	147	272	1e-24	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	2.55e-47	151	292	2	154	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
pfam01522	Polysacc_deac_1	1.34e-32	145	270	3	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10966	CE4_yadE_5s	2.18e-29	149	299	3	162	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
COG0726	CDA1	2.03e-28	86	271	1	184	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10970	CE4_DAC_u1_6s	2.85e-28	153	301	5	154	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY32711.1	1.15e-43	27	294	7	264
AEI34796.1	1.21e-22	51	292	1	232
AAK76800.1	1.21e-22	51	292	1	232
ADZ22836.1	1.21e-22	51	292	1	232
QCW81993.1	2.64e-22	88	306	9	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	7.78e-100	81	304	4	227	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
6GO1_A	2.80e-18	85	276	99	285	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	8.61e-48	70	294	49	264	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6GDD6	1.09e-14	106	292	74	271	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q6G606	1.49e-14	106	292	74	271	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q7A349	1.49e-14	106	292	74	271	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1
Q8NUI6	1.49e-14	106	292	74	271	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000006	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
16	38