CAZyme Information: MGYG000003357_00593

Basic Information

• Species: Streptococcus alactolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus alactolyticus
• CAZyme ID: MGYG000003357_00593
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200	MGYG000003357_27|CGC1	22047.05	6.4874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003357	1593339	MAG	China	Asia

• Gene Location: Start: 21208; End: 21810 Strand: -

Full Sequence      

MFKCIRRLVILGLVFFAGFQIHDTYVNVHNVLQYKTMVKEILATNDTTANVDLVLAMIYT
ETKGSDGDVMQSSESTSGVANSITDSQTSIRQGVTLLSKNLTLAEEKGVDVWTAVQAYNF
GTAYIDYVANHGGKSTIALATEYSKNVVAPSLGNTTGESYFYHHPIALISGGKLYKNGGN
IYYSREVHFNLYLIELMSLF

Enzyme Prediction     

No EC number prediction in MGYG000003357_00593.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	4.62e-81	30	191	3	165	Lysozyme-like.
cd16891	CwlT-like	3.26e-64	34	187	1	146	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	6.25e-05	36	192	126	281	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQG79377.1	1.06e-111	1	200	1	200
CBZ48189.1	1.06e-111	1	200	1	200
AQP42085.1	1.06e-111	1	200	1	200
CBI13532.1	1.06e-111	1	200	1	200
BAK27899.1	1.06e-111	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	1.97e-17	51	182	46	170	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	2.31e-15	31	188	24	174	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5XC63	4.47e-93	1	200	1	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q8P120	6.34e-93	1	200	1	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1
Q99ZN9	6.34e-93	1	200	1	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
P0DC90	5.19e-92	1	200	1	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	5.19e-92	1	200	1	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.680376	0.170878	0.146146	0.000430	0.000306	0.001858

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003357_00593.