CAZyme Information: MGYG000003357_00893

Basic Information

• Species: Streptococcus alactolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus alactolyticus
• CAZyme ID: MGYG000003357_00893
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196	MGYG000003357_36|CGC1	22119.32	9.3851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003357	1593339	MAG	China	Asia

• Gene Location: Start: 13403; End: 13993 Strand: -

Full Sequence      

MSSRFSFKQFLLFIAVFLVGVVTPLYLNRSVPSSSEKMAVSYNQKAFFEEIAPTVQKVAK
SYGVSPSIILAQAALESDYGSNLLAVKYHNLFAIKAQSGQKSVKLTYQTYFLNKWQTKEG
RFVVYKSWTDAIYDYCDLLQSGKLHDSQSAYDILVSNKGYKKPAQALQDIGFSSDPDYAT
KLIKIIETYDLTKYDA

Enzyme Prediction     

No EC number prediction in MGYG000003357_00893.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	191	4.8e-31	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.27e-51	9	196	5	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.20e-31	37	195	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	7.14e-21	33	195	309	472	amidase domain-containing protein.
pfam01832	Glucosaminidase	1.97e-20	52	191	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	3.86e-20	30	188	139	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEZ61630.1	3.48e-92	1	195	1	195
VTT07702.1	4.94e-92	1	195	1	195
SQG55608.1	4.94e-92	1	195	1	195
AGS04805.1	4.94e-92	1	195	1	195
VEB83731.1	7.01e-92	1	195	1	195

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.64e-16	44	195	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	3.68e-12	45	186	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.34e-12	45	186	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5T1Q_A	9.51e-12	41	195	57	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3K3T_A	3.12e-11	45	186	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.68e-22	8	195	8	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	4.36e-20	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	1.52e-19	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	3.91e-19	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	9.96e-17	43	195	61	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.960206	0.033255	0.000472	0.000257	0.000157	0.005679

TMHMM  Annotations     

start	end
10	28