CAZyme Information: MGYG000003357_01166

Basic Information

• Species: Streptococcus alactolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus alactolyticus
• CAZyme ID: MGYG000003357_01166
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221		24890.76	9.5093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003357	1593339	MAG	China	Asia

• Gene Location: Start: 58725; End: 59390 Strand: -

Full Sequence      

MAKKARKYPSQKRRKKRRRKRRSSKMPKGLLKTAIALAALFSAVFFGQRYYQELHRIAIA
DTANLETPSQDTQTFIQTIGEDARYIAAQNDLYASVMIAQAILESNSGQSALSQAPNYNF
FGIKGDYNGKSVTMQTWEDDGNGNAYTIDAAFRSYDNPMESLEDYAQFLQKNIYAGVRKS
NTNSYQDATAALTGVYATDTSYGAKLNQIIEEYHLTDYDTN

Enzyme Prediction     

No EC number prediction in MGYG000003357_01166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	80	215	3e-31	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	3.41e-65	69	219	317	472	amidase domain-containing protein.
COG1705	FlgJ	2.85e-61	69	220	40	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	6.20e-61	73	220	151	304	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	1.61e-31	69	213	5	139	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	1.50e-22	68	219	156	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALT82715.1	1.96e-84	3	220	10	218
QCE36956.1	2.16e-84	25	220	24	221
SQF42508.1	5.58e-84	3	220	10	218
SQI08749.1	5.58e-84	25	220	21	218
QQE31182.1	5.58e-84	3	220	10	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.49e-43	73	219	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	3.76e-42	69	219	57	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	7.83e-15	71	212	2	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.06e-14	71	212	2	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	3.35e-43	56	220	164	334	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q2G222	1.27e-40	69	219	317	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
A2RHZ5	2.87e-36	55	219	44	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	7.77e-36	55	219	44	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	1.55e-35	55	219	44	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999731	0.000265	0.000002	0.000001	0.000000	0.000009

TMHMM  Annotations     

start	end
29	51