CAZyme Information: MGYG000003357_01455

Basic Information

• Species: Streptococcus alactolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus alactolyticus
• CAZyme ID: MGYG000003357_01455
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
152	MGYG000003357_50|CGC2	17425.69	10.0369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003357	1593339	MAG	China	Asia

• Gene Location: Start: 64140; End: 64598 Strand: +

Full Sequence      

MKKLKVCLVGSSGGHLTHLYMLKPFWQDKDRFWVTFDKEDARSLLKGEKMYSVYYPSNRS
IKALLINTWRALKILPKEKPDLIISSGAAPAIPFFWIGKLMGAKTIYIEVFDRIDASTIA
GKLCYPVADKFIVEWEEMKKVYPKAVNLGSIF

Enzyme Prediction     

No EC number prediction in MGYG000003357_01455.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08660	Alg14	1.46e-16	6	149	1	169	Oligosaccharide biosynthesis protein Alg14 like. Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane.
COG0707	MurG	3.98e-10	3	145	1	154	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	1.82e-04	59	145	69	152	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam13439	Glyco_transf_4	0.007	37	107	30	101	Glycosyltransferase Family 4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDB89931.1	4.87e-103	2	152	3	153
SEU05545.1	1.56e-97	3	152	5	154
BCJ97356.1	3.62e-92	2	152	6	156
ADZ07973.1	1.85e-88	4	152	1	149
AUJ28483.1	1.85e-88	4	152	1	149

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6CF02	2.24e-08	55	151	115	215	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG14 PE=3 SV=1
Q6BMD0	3.54e-08	42	151	121	231	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG14 PE=3 SV=2
Q5A5N6	6.04e-08	77	151	138	218	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG14 PE=3 SV=1
Q6CJG3	1.30e-07	36	151	119	235	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG14 PE=3 SV=1
O14199	2.01e-07	80	151	133	209	UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003357_01455.