CAZyme Information: MGYG000003358_02050

Basic Information

• Species: Kluyvera ascorbata
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata
• CAZyme ID: MGYG000003358_02050
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000003358_91|CGC1	75494.6	9.2104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003358	4968008	MAG	United States	North America

• Gene Location: Start: 28164; End: 30185 Strand: +

Full Sequence      

MIGIYSSGIWKTPHLEAFLGEPGIKLTPHHNLASTRLRAIAVWGERPSAQRPIKLARQAG
IPILRLEDGFTRSLGLGVNGAPPLAMVMDDLSIYYDARTPSRLEKLIQAAAVDPYQENEA
QRAITMIVNHDLSKYNHAPPFSAHVSGKEVVLVIDQTFGDISVTLGGANEQQFSAMLASA
CREHPRAEIWIKTHPDVLSGKKRGYFNVQPIDPRIQLIVEDVSPQSLLRHATRVYTVTSQ
YGIEALMAGKKVVCFGLPWYAGWGITDDRHPDAPALAARRGSAPLTALVSAAWLRYSRYI
DPYTGERATLFDVLDYLHLNRTHRLARRGHLWAPGMTLWKSSIVKPFLRTSDNRVSFSRR
CKEATACIVWGIQGEERWKEDAEARNLPIWRMEDGFLRSSGLGSDLQAPLSLVLDKTGIY
YDATRPSDLEHLLNHSLLTIEQKLRASHLHRHLVENKLSKYNLGEGWQCPPTGGKRVLLV
PGQVENDASIATGTLSINTNLALLHTVRERYPDAFIIYKPHPDVLTGNRPGHIAEAEMSR
LADCVALDVDIIECIQQADELHTMTSLSGFEALLHGKQVYCYGQPFYSGWGLTVDEHPNT
RRQRSLTLQDLIYQALIAYPTYIHPRDQRVITVEAAAAWLTTQTRPAMAAKRKANRLVRL
CRKAINFYRVKFI

Enzyme Prediction     

No EC number prediction in MGYG000003358_02050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	278	669	2.2e-143	0.7462406015037594
GT107	9	323	2.4e-104	0.5939849624060151

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	670	6	669	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	1.76e-152	368	622	4	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	4.69e-139	40	302	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	2.26e-121	367	622	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	6.34e-100	40	299	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV67716.1	0.0	1	673	1	673
BBT72535.1	0.0	1	655	1	654
BBQ85597.1	0.0	1	655	1	654
BBR22595.1	0.0	1	655	1	654
BBS98391.1	0.0	1	655	1	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	1.04e-141	2	350	3	351	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	6.58e-76	2	317	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	5.74e-69	337	636	10	314	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	1.86e-301	1	672	1	674	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	7.37e-200	4	643	26	674	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	2.96e-199	4	643	26	674	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	1.26e-54	335	622	80	381	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003358_02050.