CAZyme Information: MGYG000003358_04388

Basic Information

• Species: Kluyvera ascorbata
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata
• CAZyme ID: MGYG000003358_04388
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239	MGYG000003358_180|CGC1	26757.1	10.4498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003358	4968008	MAG	United States	North America

• Gene Location: Start: 12751; End: 13470 Strand: +

Full Sequence      

MALRKVAGLKQLFWRLLLLLALFWGGGIAAFSFLPVPFSAVMIERQLGAWMTGDFGYVAH
SDWVSMDAISPFMGLAVIAAEDQKFPDHWGFDVSAIEKALAHNERNENRIRGASTLSQQT
AKNLFLWDGRSWVRKGLEAGLTLGMETVWSKKRILTVYLNIAEFGDGIFGVEAASQRYFH
KPASRLTMAEAALLAAVLPNPLRFKASAPSGYVRSRQAWILRQMRQLGGEGFMRENKLY

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	57	225	5.4e-57	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	3.15e-131	26	237	25	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.38e-88	28	230	22	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.12e-72	34	229	50	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	6.92e-62	57	225	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	7.91e-31	64	228	70	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV64118.1	1.90e-172	1	239	1	239
QIR25817.1	1.80e-161	1	239	1	239
BBQ82035.1	4.96e-159	1	239	1	239
BBT69251.1	4.96e-159	1	239	1	239
BBR19039.1	4.96e-159	1	239	1	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	4.16e-27	63	228	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.62e-26	63	228	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	6.35e-23	76	228	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
7U4H_A	9.87e-20	76	204	55	181	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5U2G_A	2.40e-19	76	201	55	180	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AQ99	1.21e-147	6	239	9	242	Biosynthetic peptidoglycan transglycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mtgA PE=3 SV=1
Q48465	1.58e-143	9	239	12	242	Biosynthetic peptidoglycan transglycosylase OS=Klebsiella oxytoca OX=571 GN=mtgA PE=3 SV=1
B4TWH8	6.41e-143	1	238	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=mtgA PE=3 SV=1
A9N776	2.61e-142	1	238	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=mtgA PE=3 SV=1
B5F6X7	7.47e-142	1	238	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella agona (strain SL483) OX=454166 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999907	0.000090	0.000003	0.000000	0.000000	0.000019

TMHMM  Annotations     

start	end
12	34