CAZyme Information: MGYG000003359_00502

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_00502
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42655.56	4.8302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 355767; End: 356888 Strand: -

Full Sequence      

MNSAQTDFEKGREEALTPLQWAEKACEALMAKYEPEQLPPDWFHYHQGVFLSGMEQCWRE
TGKPQYFDYIKRWVDSHVLEDGSIKKCHTGELDDIQPGVLLFNLYEQTGDERYKKALDQL
VPLLKSWPTNPSGGFWHKDHLPNQMWLDGLYMAGPIAVQYAKTFGASEYFDTMTYQAILM
AERTRDPKTGLLYHGWDETKEAEWADPVTGLAPEFWGRAMGWYPIALLEMFEFLPEDHKD
KAKLIDILQDLLISLSRYQDATTGLWYQVVDKGDRADNWVEVSCSAMYVLSIAKAVRLGY
LDAKYLEVARKGYRGVIDTLKFDENGKMILGHICIGTGIGDYAHYVARPTSENDLHGVGA
FILMCVEMSRATL

Enzyme Prediction     

No EC number prediction in MGYG000003359_00502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	370	9.6e-115	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.86e-119	17	371	7	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.82e-117	21	370	1	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFC29184.1	1.30e-229	16	371	8	363
AEI40556.1	4.34e-228	16	371	8	363
AFH61356.1	6.17e-228	16	371	8	363
ANY68695.1	6.92e-227	13	371	5	363
AZK46659.1	4.81e-222	17	371	9	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	1.13e-118	17	368	12	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.64e-118	17	368	2	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	1.06e-86	41	367	21	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3PMM_A	1.16e-26	41	370	67	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	9.61e-25	41	340	66	348	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.20e-118	17	368	12	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.51e-26	152	367	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.51e-26	152	367	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_00502.