CAZyme Information: MGYG000003359_00519

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_00519
• CAZy Family: CBM46
• CAZyme Description: Endoglucanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		43860.59	4.3728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 374305; End: 375537 Strand: -

Full Sequence      

MVAMTENDTVPSLQNLTEEKAGWLYFCPWYGEHLMSSAFNDPATLKTLYQSDYVITLDEL
PDLTVENPIPSASITPANVEFDKNAPGQSDQAITVNFNGNTLTALRAGTNALTANQDYTL
NGSTLLLKKEFLAGLPVGTHSIVFDFNQGQDPVLKVKVVDSTPSSSISPVNANFDQAANL
QQDISVSLALNGHQLASLTNGNVTLTSGQDYTASSAAVVLSKSYLSTLPLGQHAITFHFS
GGNHAVLTVNVVDSSVPAPAGDLTIQAFNGNTSASTNGISPRFKIVNTGDSAIPLSDVKL
RYYYTIDGEKAQNFWCDWASIGSEKVTGHFVKLATPVAGADYALEIGFTSSAGTLNPGQS
AEIQARFSKTDWSNYNQADDYSFKASGNQFANHEQVTGYMNGQLVWGIEP

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM3	267	347	8.6e-30	0.9772727272727273
CBM46	88	151	8.5e-16	0.7816091954022989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00942	CBM_3	3.10e-30	265	346	1	82	Cellulose binding domain.
pfam03442	CBM_X2	9.65e-28	74	156	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.
smart01067	CBM_3	4.85e-26	265	347	1	83	Cellulose binding domain.
pfam03442	CBM_X2	2.86e-25	167	249	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASR49482.1	9.88e-247	1	409	450	858
ANY70180.1	1.17e-242	1	410	449	858
QLG42866.1	4.22e-238	1	410	448	859
AIQ59300.1	7.08e-234	1	410	449	858
AIQ47924.1	6.94e-233	1	410	449	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZQW_A	2.39e-55	262	410	5	153	ChainA, CELLULOSOMAL SCAFFOLDIN [Acetivibrio cellulolyticus],3ZU8_A Chain A, Cellulosomal Scaffoldin [Acetivibrio cellulolyticus],3ZUC_A Chain A, CELLULOSOMAL SCAFFOLDIN [Acetivibrio cellulolyticus]
4JO5_A	2.60e-48	260	410	16	172	ChainA, Cellulosome anchoring protein cohesin region [Acetivibrio thermocellus YS]
1NBC_A	6.81e-48	262	410	1	155	ChainA, Cellulosomal Scaffolding Protein A [Acetivibrio thermocellus],1NBC_B Chain B, Cellulosomal Scaffolding Protein A [Acetivibrio thermocellus]
6D5B_A	8.36e-47	260	410	16	167	Structureof Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_B Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_C Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_D Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_E Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_F Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_G Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_H Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_I Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_J Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_K Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_L Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
4B9F_A	2.63e-46	262	407	1	152	ChainA, Cellulosomal-scaffolding Protein A [Acetivibrio thermocellus ATCC 27405],4B9F_B Chain B, Cellulosomal-scaffolding Protein A [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23659	6.54e-99	71	410	649	986	Endoglucanase Z OS=Thermoclostridium stercorarium OX=1510 GN=celZ PE=1 SV=1
Q3MUH7	1.89e-83	165	410	781	1027	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
P50900	1.52e-72	138	410	649	914	Exoglucanase-2 OS=Thermoclostridium stercorarium (strain ATCC 35414 / DSM 8532 / NCIMB 11754) OX=1121335 GN=celY PE=1 SV=2
Q02934	1.93e-50	261	410	738	887	Endoglucanase 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celI PE=1 SV=2
P10474	9.09e-44	255	410	414	570	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_00519.