CAZyme Information: MGYG000003359_01649

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_01649
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000003359_15|CGC8	38731.17	5.5379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 199372; End: 200403 Strand: +

Full Sequence      

MLKLNTAPSELKPIIERVAEHTFGMDLTWDWPCGVAYYGISRAFEATGEAAYVERMVQWC
DEYIEAGLPVWTVNACAMGHMLLTLYEQTKEQKYLDLILSKIDYLQNQAPRFGDRVLQHT
VSAGNDFPEQCWADTLFMAAYFMLRTGVMLGEKPWIDDALHQFYWHINYLQSESTGLWYH
GYNHLSKDHMSGIYWGRANAWAAYTMSRAAKGLPEAYLYPPMMHLWSSLRDQLAALKKLQ
HEDGLWGTVLDYPNAYGEVSATAGIAAAMITQGNPLHAKYVQKALDGVLSNITEQGRVLN
VSGGTAVMKDIEGYLQVDRKWAQGWGQGLTLALLAAVIENEQR

Enzyme Prediction     

No EC number prediction in MGYG000003359_01649.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	337	5.7e-77	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.18e-90	1	337	6	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.36e-76	16	331	14	333	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS48636.1	1.21e-208	2	339	1	338
QNK60304.1	1.05e-206	2	343	1	342
ANY76770.1	1.54e-203	2	339	3	341
ACX67065.1	1.66e-203	2	339	3	341
AIQ51125.1	2.18e-200	2	339	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	5.58e-40	29	340	66	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.07e-39	29	340	65	379	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.30e-38	29	334	47	365	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	3.34e-19	29	270	23	275	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.78e-109	1	343	1	341	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
T2KPL9	4.46e-06	30	298	57	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_01649.