CAZyme Information: MGYG000003359_02244

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_02244
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1325		139255.23	4.5815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 100225; End: 104202 Strand: -

Full Sequence      

MKSQRRIIAWICVVTLFAATFFTSAGWTAPVRAAGGPNLAAGKPVTESGHADVYVASNVA
DGNADTYWESTNNAFPGWVQVDLGSAVLIDQVVLKLPSGWESRSQTLSVQGSTNGSSFTD
LKASASYTFDPGTANTVAINFTAASARYVRIQITANTVWPAGQLSEVEVYGASPAAPAAI
PGKIEAESYSAMNGIQTEPTSDSGGGLNVGWIHVGDWLDYNVNVQNAGTYTVEYRVASNA
GTGAIQLQSGGSTLATTTVPNTGGWQNWQTVTANVTLNAGTQTLRVYASGYDFNINWIGF
TPGSTADTQPPTAPANLAFTQPTAGSVKLTWSAATDNVGVTGYDVYANGQLRGSVNGSTL
TYTDPQPAGVTVSYYVIAKDAAGNASAPSNTVTRNGSGEGDGSNLAIGKTMTASSSTFTF
VAANANDNDTATYWEGNGHPSTLTADLGANANITSIVLKLNPSSEWATRTQTIQVLGHDQ
NATSFTNLVSAASYTFNPASQNTVTIPVSATVSQIQLRFTANSGAPGGQIAEFQVIGTPA
PNPDLTVTGISWSPAAPDETQAVTLNATVRNAGTVASTATSLNFYLGSTLVGTASVGALA
PGTTANVSANIGAKEAGSYAVVAKVDENNAVIETNDGNNSYTHTSQLTIGQVQSSDLIAA
AAWTPSNPSAGNTVTFTVNLKNQGTMASAGGAHAITLELKNGSGATVQTFNGSYSGSLAP
GASANVTLGTWTAVNGSYTVTTTVAADANEVAVKRNNNTATASLYSGRGANMPFTVLEAE
ASSNSTNGTKLAPNFTPGDFAGEASGRSAVYLDATGEYVEFTLTSPANAFVLRNAVAENT
TGTVSIYANGVDKGNFNVTSKFSYLYATPSTLGRLGYDNSGSKAYWLYEDSQLLLDQVYP
AGTKIRIQKDAGDVPWIYVDMIETENVAPPATNPDPSKYVQVSSTKSIEQALNEFRQDSS
KKGIFIPAGEWTISSKIFLYGRATEIIGAGPWHTKLVAPQDQTNTDVGFNISSAANGSTI
KNLSAWGNYIYRQDGPGKFIDGNGMQNVTVENVWAEHFVCLYWGVNSSYNTFKNNRIKNM
FADGINMTNGSSYNVIDNNYARGTGDDSFALFSAIDAGGSYNVGNKYTNLTAVNVRRAAA
FAVYGGQNNLFQNLYGADTLTYPGVTISSLSFGYNTLGFGDQDTVIDGVTLDRTGGDFWT
SVGADDKINDYQNFGAIWFFGGDRDFKNILVKNIDINNPVYFGLMFQSKSPENLPMQNIR
LENITINNPTRYGIKLVVRAEDGQGPAVGEARFTNVKVNNPGITAIYGENQSPNFHVIRG
AGNNW

Enzyme Prediction     

EC	3.2.1.59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	397	1307	1.4e-171	0.9748743718592965
CBM6	185	301	1.5e-35	0.8623188405797102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	2.05e-52	769	924	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
cd04080	CBM6_cellulase-like	2.70e-44	182	301	3	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
smart00606	CBD_IV	1.36e-34	182	300	6	129	Cellulose Binding Domain Type IV.
pfam03422	CBM_6	1.93e-33	185	302	1	125	Carbohydrate binding module (family 6).
cd04084	CBM6_xylanase-like	4.69e-24	183	300	2	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANS76644.1	0.0	1	1325	4	1330
QTH42681.1	0.0	2	1325	5	1328
QMV42812.1	0.0	1	1325	4	1328
AYQ75762.1	0.0	20	1325	5	1309
AZS18146.1	0.0	13	1325	1	1316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K0S_A	0.0	761	1325	6	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0Q_A	0.0	761	1325	6	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1068A in complex with nigerose [Paenibacillus glycanilyticus],6K0U_A Catalytic domain of GH87 alpha-1,3-glucanase D1068A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0P_A	0.0	761	1325	6	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0M_A	0.0	761	1325	6	573	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
7C7D_A	5.97e-36	769	1323	54	575	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	3.83e-18	184	301	413	533	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
P20533	2.25e-15	307	393	556	641	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P27050	7.48e-11	299	393	83	174	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
A0P8X0	3.34e-09	307	393	811	896	Alpha-amylase OS=Niallia circulans OX=1397 GN=igtZ PE=1 SV=1
P45796	4.22e-09	183	375	380	589	Arabinoxylan arabinofuranohydrolase OS=Paenibacillus polymyxa OX=1406 GN=xynD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000772	0.997911	0.000449	0.000430	0.000226	0.000180

TMHMM  Annotations     

start	end
7	29