CAZyme Information: MGYG000003360_01093

Basic Information

• Species: Enterobacter_D kobei_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter_D; Enterobacter_D kobei_A
• CAZyme ID: MGYG000003360_01093
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1175		132272.66	5.9896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003360	4794474	MAG	United States	North America

• Gene Location: Start: 107; End: 3634 Strand: +

Full Sequence      

MSMARPALVSIIIPTYKTTWFEQALASAMAQDYPQCEIIVSDDSPYGEPAEIVKICQEKS
RHPIIYFRNKPALGDVGNHEKCFRESKGKYIKLFSDDDLLAPDCVSELVSAIEASDEIRI
ATSRRIRINAVNKVQPDIPATASPVMKSSVIHGDDFFAFQQKHAVNFIGEPCAVLMHRED
IVELMDMPDGLFSLDGELMIYLEDLTLFSKVLRKGHIAYITKPLSSFRISRSQKSEQARA
EKDRSERSRELYRQFVADLAAERNVMGDSVRVASLHSPKDFVYQDIHDAMAHDLKQRYFA
HWLGERTLLPVQETLIDDYLTQNGLSTTLLVVVNATDAPEAALAATLDSLPRQARTGLAV
ETIVIGEATSADVSYFSANRDSKMAAFNTVITETQSDWLIFVDAGTEFHPSGLTALTTTL
TQAGELLAVYCDESFTLDGRRVGAKFRPDFNLDLLLSSPANMAHRWLWRREVLQAAGGFD
PKLSGAYELDLTLKIIETQGFNALGHLGEQLLHLPATEENHAEEIAVVQRHLNNRGYAHA
EVELAAYGNLRLRYHHTGTPLVSLVVIGDDDTAALMSCVLKIIEKTAWLNYELIMVVNDR
QNVETQRWLDSVVAVDPTRISVVRGSGEWRYATRANLGASVAQGEYLCLLHSGVAIIENE
WLNNLLNHGERPEVGIVGGKQVYADGTIRHAGYVLGVNGVAGEAFYGMYDVNKGHMLRLH
ADQNYSAVSGDFMLVRRDVFININGMDEKLHHHSDVDFCLRARQQGFLTVWTPYARVLRS
VTASKPHDEKAREKLDRQAERDDDELYRRWMPLIANDPAYNVNLSLTGGEFNVCPDSLLS
WRPLDWKPLPVVLPHMGDFAGCGYYRIIKPFETMRDAGIVDGKLSDTFLSVPYMARYKPD
SIIMQRQLTAEFHEWARIVGKRTDVFKVFELDDFLPNIPLKNQHRAEFGNDIMKMLRKSL
GYMDRFVVSTEPLAEAFANAHPDIVVRKNRLSYDWWDNLTSLRGQGDKPRVGWAGGSSHT
GDLEMIFDVIKAFANDVDWIFFGMCPPKLRPYVKEFHFGVDIELYPKKLASLNLDLALAP
VEDNHFNACKSNLRLLEYGACAIPVICSDVPCYRGSLPVTRVRNRFKDWQGAIRMHLADS
QASAQMGRALYQAIRSDYMLDYNAAEEWAKAWLPG

Enzyme Prediction     

No EC number prediction in MGYG000003360_01093.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.19e-16	580	778	16	163	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd03794	GT4_WbuB-like	4.55e-14	928	1167	127	388	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd04184	GT2_RfbC_Mx_like	7.71e-14	8	135	2	131	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG1216	GT2	9.30e-14	631	778	69	218	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	1.30e-13	11	123	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAR45855.1	0.0	1	1174	1	1174
AWQ18411.1	0.0	1	1174	15	1189
QZY96359.1	0.0	3	1172	1	1166
QZY91809.1	0.0	3	1172	1	1166
QDY42267.1	0.0	3	1172	1	1166

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.67e-49	386	831	439	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.02e-38	299	830	293	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WLV8	1.68e-06	4	187	15	207	Uncharacterized protein MT1568 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1568 PE=4 SV=1
P9WLV9	1.68e-06	4	187	15	207	Uncharacterized protein Rv1518 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1518 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003360_01093.