CAZyme Information: MGYG000003360_02373

Basic Information

• Species: Enterobacter_D kobei_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter_D; Enterobacter_D kobei_A
• CAZyme ID: MGYG000003360_02373
• CAZy Family: CE14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	MGYG000003360_42|CGC6	25018.51	7.1115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003360	4794474	MAG	United States	North America

• Gene Location: Start: 368592; End: 369266 Strand: +

Full Sequence      

MDSKHIGNVNYLMANSRTGILAIGAHPDDIELGCGATLANLAQKGFHITAIILTAGNAGC
ASGISRHDESRQALNILGCQDLFTFHFEDTRTEHYLDAIITSIDDVIKTQQDAGIRFLRA
YTMHDKDRHQDHRAAHQASMVACRTIPQILCYETPSCRLSFVPQAFEEFNEAGLENKISA
LKFHQSHKHRQYMQPTYIRSLAQFRGLQAGMALCEGFVVQKMIL

Enzyme Prediction     

No EC number prediction in MGYG000003360_02373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	21	109	2e-17	0.8387096774193549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2120	LmbE	3.01e-27	20	210	13	218	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	2.90e-24	22	140	1	125	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.
TIGR04001	thiol_BshB1	2.84e-18	20	224	4	225	bacillithiol biosynthesis deacetylase BshB1. Members of this protein family are BshB1 (YpjG), an enzyme of bacillithiol biosynthesis; either BshB1 or BshB2 (YojG) must be present, and often both are present. Bacillithiol is a low-molecular-weight thiol, an analog of glutathione and mycothiol, and is found largely in the Firmicutes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ99697.1	2.32e-14	20	217	3	217
ANE45814.1	2.26e-13	20	217	3	217
BBI35200.1	8.61e-13	20	218	3	221
QOW11347.1	3.26e-12	17	143	2	123
ASU32896.1	3.78e-12	8	218	27	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BMO_A	1.06e-06	20	94	18	99	LnmXprotein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus],5BMO_B LnmX protein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus],5BMO_C LnmX protein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus]
2IXD_A	2.58e-06	20	132	6	113	Crystalstructure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus],2IXD_B Crystal structure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus]
6P2T_A	2.77e-06	20	132	26	133	BshBfrom Bacillus subtilis complexed with citrate [Bacillus subtilis subsp. subtilis str. 168],6ULL_A BshB from Bacillus subtilis complexed with a substrate analogue [Bacillus subtilis subsp. subtilis str. 168]
1UAN_A	4.31e-06	20	142	4	121	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71311	9.51e-67	14	186	13	185	Uncharacterized deacetylase YaiS OS=Escherichia coli (strain K12) OX=83333 GN=yaiS PE=3 SV=1
Q81ST8	9.94e-06	20	132	6	113	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus anthracis OX=1392 GN=bshB1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999961	0.000066	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003360_02373.