CAZyme Information: MGYG000003360_02939

Basic Information

• Species: Enterobacter_D kobei_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter_D; Enterobacter_D kobei_A
• CAZyme ID: MGYG000003360_02939
• CAZy Family: PL22
• CAZyme Description: Oligogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000003360_45|CGC5	44615.61	4.7337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003360	4794474	MAG	United States	North America

• Gene Location: Start: 160107; End: 161282 Strand: +

Full Sequence      

MAKGMRVKLQYDVSRDPDTGAEITRLTPPEVTCHRNYFYQKCFFNDGSHLLFAGEFDGHW
NYYLLDLEQAEAVQLTEGSGDNTFGGFLSPDDRFLYYVKNDRTLREVDLTTYAEREVYRV
SDEWVGYGTWVANSDCTKLVGIEIAKSDWTPLTDWQLFHDFFHKGPHCRLLRIDLQTGES
TVIHDEKIWLGHPIYRPFDDNTVAFCHEGPHDLIDARMLLVNEDGSNVRKVKDHAEGESC
THEFWVPDGSALVYVSYLKGQQGRTISRFDPDTGINEDVMQMPACSHLMSNFDGTLLVGD
GSGTPVDVKDTGGYTIDNDPYLYVFDVAQRKYFRVARHDTSWATFENSRQVTHPHPSFTP
DDSAILFSSDKDGKPALYIAKLPEQRDMLQA

Enzyme Prediction     

EC	4.2.2.6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL22	215	385	1.6e-80	0.6415094339622641
PL22	32	138	8.3e-31	0.39245283018867927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14583	Pectate_lyase22	0.0	1	385	1	385	Oligogalacturonate lyase. This is a family of oligogalacturonate lyases, referred to more generally as pectate lyase family 22. These proteins fold into 7-bladed beta-propellers.
COG0823	TolB	2.14e-31	15	363	72	403	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
PRK00178	tolB	2.08e-10	245	378	206	314	Tol-Pal system protein TolB.
PRK04792	tolB	2.08e-09	245	378	225	333	Tol-Pal system protein TolB.
PRK05137	tolB	1.74e-06	197	379	162	318	Tol-Pal system protein TolB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCU54314.1	7.18e-308	1	391	1	391
QAR44967.1	2.94e-282	1	390	1	390
AST70729.1	2.94e-282	1	390	1	390
AZI86265.1	4.88e-281	1	390	1	390
APZ04603.1	4.00e-280	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PE7_A	9.29e-213	1	384	1	384	Oligogalacturonatelyase in complex with manganese [Yersinia enterocolitica subsp. enterocolitica 8081]
3C5M_A	8.65e-192	2	390	2	390	Crystalstructure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_B Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_C Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P21258	5.63e-209	1	384	1	384	Oligogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=ogl PE=2 SV=2
Q59418	1.53e-206	1	384	1	384	Oligogalacturonide lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=ogl PE=4 SV=2
A5VS52	8.72e-06	198	379	172	327	Tol-Pal system protein TolB OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=tolB PE=3 SV=1
A9M7J5	8.72e-06	198	379	172	327	Tol-Pal system protein TolB OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 GN=tolB PE=3 SV=1
A9WWH3	8.72e-06	198	379	172	327	Tol-Pal system protein TolB OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=tolB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003360_02939.