CAZyme Information: MGYG000003360_03427

Basic Information

• Species: Enterobacter_D kobei_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter_D; Enterobacter_D kobei_A
• CAZyme ID: MGYG000003360_03427
• CAZy Family: GH104
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158	MGYG000003360_59|CGC1	17509.97	10.3163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003360	4794474	MAG	United States	North America

• Gene Location: Start: 11393; End: 11869 Strand: -

Full Sequence      

MQTLNKQRKAFLDMLAWSEGTDKPGQPTRNRGYDVIVGGSLFTSYADHPRKLVTLNPKLK
STAAGRYQLLSRYWDAYRIQLGLKDFSPASQDAVALQQIKERGALPLIDKGDIRQAIDRC
SNIWASLPGAGYGQFEHKADNLIARFKAAGGKVSEPKS

Enzyme Prediction     

EC	4.2.2.N1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH104	4	149	1.3e-61	0.9793103448275862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00736	lambda_lys-like	5.23e-76	6	151	1	141	Bacteriophage lambda lysozyme and similar proteins. Lysozyme from bacteriophage lambda hydrolyzes the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), as do other lysozymes. However, unlike other lysozymes, bacteriophage lambda does not produce a reducing end upon cleavage of the peptidoglycan, but rather uses the 6-OH of the same MurNAc residue to produce a 1,6-anhydromuramic acid terminal residue and is therefore a lytic transglycosylase. An identical 1,6-anhydro bond is formed in bacterial peptidoglycans by the action of the lytic transglycosylases of E. coli, though they differ structurally.
COG4678	COG4678	1.68e-74	7	155	29	180	Muramidase (phage lambda lysozyme) [Cell wall/membrane/envelope biogenesis, Mobilome: prophages, transposons].
pfam00959	Phage_lysozyme	2.91e-23	33	140	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
cd00442	Lyz-like	1.29e-04	55	98	16	59	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATX88198.1	4.28e-102	1	156	1	156
QPB30583.1	1.74e-101	1	158	1	158
ANZ87748.1	3.52e-101	1	158	1	158
ANZ87820.1	3.52e-101	1	158	1	158
AGB78456.1	5.00e-101	1	155	1	155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D9U_A	9.50e-95	1	153	1	153	ChainA, Bacteriophage Lambda Lysozyme [Lambdavirus lambda],1D9U_B Chain B, Bacteriophage Lambda Lysozyme [Lambdavirus lambda],3D3D_A Chain A, Lysozyme [Lambdavirus lambda],3D3D_B Chain B, Lysozyme [Lambdavirus lambda]
1AM7_A	2.35e-89	1	155	1	155	ChainA, LYSOZYME [Lambdavirus lambda],1AM7_B Chain B, LYSOZYME [Lambdavirus lambda],1AM7_C Chain C, LYSOZYME [Lambdavirus lambda]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P03706	1.46e-94	1	155	1	155	Endolysin OS=Escherichia phage lambda OX=10710 GN=R PE=1 SV=1
P51771	3.60e-45	10	151	12	162	Endolysin OS=Escherichia phage P2 OX=10679 GN=K PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003360_03427.