CAZyme Information: MGYG000003361_00126

Basic Information

• Species: Collinsella sp900556495
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900556495
• CAZyme ID: MGYG000003361_00126
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000003361_3|CGC1	53602.84	4.7005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003361	2140862	MAG	United States	North America

• Gene Location: Start: 157606; End: 159006 Strand: +

Full Sequence      

MEQFTLPDDFFFGAAMSGPQTEGEWNTGGKLENLWDTWSQENLSDFYNRVGSYAGNAFMA
KYQEDLRIMADLGLTTYRTSIQWSRLLDEDGNINPEGAAWYHELFRASREAGLECFVNLY
HFDMPTFLFRRGGWESREVVEAYAAYAAKAFAEFGQEVKHWFTFNEPTVEPEQRYQAGVW
YPKLHDFGRARVVQYHISVAHALATANFRAAQADGTVRADAKIGLINAFTPTYTRENPTP
EDLEAVRMMGGINNRWWLDLITKGELPVDVLDTLAENGVHLPIRPGDAEILKQGVVDWLG
CNYYHPTRVQAPASKVDEYGLPRFADEYVWPDAVMNESRGWEIYPEGLYDFGIDVRDNYP
GLEWFVSESGMGVMDEHLHRGDDYRIEDPYRVDFVRGHLEALARAIEAGSPCKGYHYWGL
IDNWSWSNAFKNRYGFVEVDLMDGYKRRLKRSADWLREVATTHVVK

Enzyme Prediction     

No EC number prediction in MGYG000003361_00126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	462	1.1e-122	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	4.73e-145	5	462	3	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
TIGR03356	BGL	2.57e-101	7	455	1	425	beta-galactosidase.
pfam00232	Glyco_hydro_1	5.09e-100	3	463	2	451	Glycosyl hydrolase family 1.
PRK13511	PRK13511	2.42e-93	3	466	2	469	6-phospho-beta-galactosidase; Provisional
PRK15014	PRK15014	2.11e-49	1	463	1	473	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70290.1	9.61e-294	1	465	1	465
ATP54210.1	1.59e-292	1	465	1	465
AEB07579.1	1.17e-257	1	466	1	466
BCV18986.1	2.11e-251	1	465	1	466
ACV50514.1	9.65e-238	3	465	2	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	8.43e-110	6	461	3	457	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	1.23e-109	6	461	4	458	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAQ_A	1.76e-102	6	459	20	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAV_A	1.76e-102	6	459	20	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	1.16e-88	6	459	11	444	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	6.19e-123	2	460	5	460	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
Q6GEP0	2.79e-74	5	466	4	470	6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=lacG PE=3 SV=1
B4U1G6	7.54e-74	6	465	5	467	6-phospho-beta-galactosidase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) OX=552526 GN=lacG PE=3 SV=1
C0MDS5	1.06e-73	6	465	5	467	6-phospho-beta-galactosidase OS=Streptococcus equi subsp. zooepidemicus (strain H70) OX=553483 GN=lacG PE=3 SV=1
P67767	1.09e-73	5	466	4	470	6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003361_00126.