CAZyme Information: MGYG000003361_00822

Basic Information

• Species: Collinsella sp900556495
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900556495
• CAZyme ID: MGYG000003361_00822
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000003361_8|CGC4	47888.5	6.9941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003361	2140862	MAG	United States	North America

• Gene Location: Start: 164044; End: 165318 Strand: +

Full Sequence      

MAPIEIFNFVVAVLFAVCFFYQFIFFIIGYVRNEVKIPKAKKQHTYAFFIAAHNEEAVIA
NLVQSIKAQDYPSELIDIFVVADACTDETAARAREAGAIVYERNDLARKGKSWVMDYGFD
RILNEYPGKHEAFIIFDADNLLAPDYVTIMNDAFDQGYLALTSYRNSKNFGSSWISAAYS
IWFLREARFLNNARMLCGTSCAVSGSGYLVSSKIVEAMHGWDFHTLTEDIQFSTFCAVHG
IQIGYAPAEFFDEQPLTLSASIKQRRRWVKGFYQVFFTYGGQLGQAIAKRRSFAAYDLLM
VIAPATLLTLITLLSNGTFLVVGGLSHGFLATDAEMQACLRSILITFGLMYVTGFMMALL
TTVIERKHIHCRPRWRVVTNLFTYPLFMFTYIPLTVSALFLKVDWVPTPHDISVTLDQVM
EGAK

Enzyme Prediction     

No EC number prediction in MGYG000003361_00822.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	46	270	2.4e-28	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	4.56e-90	48	232	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	6.30e-32	49	229	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.80e-28	6	414	16	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	6.38e-25	45	271	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06427	CESA_like_2	2.42e-18	45	279	2	237	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB07123.1	8.91e-232	1	424	8	431
QIA33195.1	4.01e-227	3	424	10	431
QWT17096.1	5.82e-227	1	420	1	420
ATP53496.1	1.89e-225	3	424	10	431
AZH69681.1	2.69e-225	3	424	10	431

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	3.26e-13	50	279	114	343	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	4.18e-12	47	279	109	341	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	1.31e-11	47	279	109	341	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
298	320
342	364
377	399