CAZyme Information: MGYG000003361_01047

Basic Information

• Species: Collinsella sp900556495
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900556495
• CAZyme ID: MGYG000003361_01047
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		67753.74	5.1016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003361	2140862	MAG	United States	North America

• Gene Location: Start: 242097; End: 243977 Strand: +

Full Sequence      

MNNNPNDLYNDKTFSNSQLMTRRGALCAAAGLGVSLFLPNVVFADEEPDASADSQQDDRL
AQSWRFRDGAPITPETNTDDDGIMLLGDGIPYGKNSAGQWCNGRGDAIPGALLRGVDVSY
FQFSIDWNAVKASGVDYAIIRAAWSAPYTDSSGTYHDGIDSYWNGNASACERVGMPYGAY
IYSYARTAAEAVREAEHLIGLMRGHKPTYPLYIDIEDDKVVGADLNAVAIAFCRRIKQAG
YQAGVYANLSFWNKYLTSSTLNNWTRWIAQYNATCDYGGRYDMWQCTSSGGISGINGSVD
INFDYVGLSNEYSSQTTWTRVYGQSHLDTMLEISKTGWDSSDAVVIATERTYWDALSASA
LAGYLGCPILLTYTGALSNQTKSEIQRLGAKTAYVVGGNIAIADAVDSQIRAAGCPTVQR
VFGQDQQGTARAIAEFIRKKSGAQSKTCIIATSWKFQDALSVSPFAFWSKSPIYLCETGS
NTLSDATVKSIQNGGFTKAIIVGGPVAVNFSVEGQLRGIGLSNVKRVYGQTEYETSQAIA
EWEISEGMGVSNMAVATGETYYDALSGGALCGKNGSVLTIVHDTNRVCLTDFIPKQKGKV
SHGFVFGGPIAVSKTSWLVLLRNYLY

Enzyme Prediction     

No EC number prediction in MGYG000003361_01047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	116	295	8.5e-40	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.84e-80	114	305	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.10e-33	114	302	1	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	6.44e-26	116	295	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	7.66e-25	114	303	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	2.01e-21	114	302	1	190	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY61389.1	3.25e-215	20	545	20	536
AWY97591.1	8.82e-64	26	303	13	283
BAN76667.1	1.95e-60	61	342	42	323
QMW70652.1	8.43e-58	33	316	22	296
BCD36479.1	8.43e-58	33	316	22	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J6Q_A	3.25e-13	323	539	291	505	ChainA, Cell wall binding protein cwp8 [Clostridioides difficile 630]
7ACY_B	6.22e-12	309	598	34	349	ChainB, S-layer protein [Clostridioides difficile 630],7ACY_D Chain D, S-layer protein [Clostridioides difficile 630],7QGQ_B Chain B, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_D Chain D, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_J Chain J, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_K Chain K, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_L Chain L, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_M Chain M, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_N Chain N, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_T Chain T, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_U Chain U, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_V Chain V, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_W Chain W, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_X Chain X, Precursor of the S-layer proteins [Clostridioides difficile 630]
7ACX_B	8.29e-12	309	598	34	349	ChainB, S-layer protein [Clostridioides difficile],7ACX_D Chain D, S-layer protein [Clostridioides difficile]
2WW5_A	9.32e-12	116	305	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	2.17e-11	116	305	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02114	5.75e-22	320	585	30	279	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
P34020	4.14e-12	113	302	1	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P26836	3.60e-07	113	410	9	299	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
Q8X7H0	7.34e-07	113	302	67	252	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000579	0.001989	0.000070	0.964625	0.032702	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003361_01047.