CAZyme Information: MGYG000003362_01342

Basic Information

• Species: Dysgonomonas sp900079735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900079735
• CAZyme ID: MGYG000003362_01342
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
826		92786.4	6.7534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003362	3888864	MAG	United States	North America

• Gene Location: Start: 100097; End: 102577 Strand: -

Full Sequence      

MKKGIYIFIFIMASVNIYSQNILTPVSFEQVTLTDNFWNNRMRIQKEVLVPVAFERTEIA
VEDLRRTANYLKGIEGPLPSHSRFSTSDLFKVIEGAAYLLKMERDPKLEKQIDDIADIIA
QAQQPDGYLYPPHITGSYKAAPLWGGAGMGDKPYSWVVHSHELYNMGHLYEAAAAYYQAT
GKKNLLDIATKSAKHINKVFFEGDPNYNGGKPVNQAPGHEEIEIALVKLYRVTGDPLYLN
MAKKFIDIRGVTYVPDGKGTMSPEYAQQHAPVRKQDKAVGHAVRAVYLYSGMSDVGTLTG
DTTLPPALDKIWGNIVDTRMHITGGLGAIHGIEGFGPEYELPNKEAYNETCAAVGNVFFN
HRMFLLEKDGKYMDVAEVSLLNNVLAGVNLEGNKFFYVNPLASDGTVDRSYWFGTACCPT
NLARLIPQISGLMYAHTDNEIYCSFYTGSKVDFPLTSGKVALEQKTNYPFDESIVLTVNP
EKNDQAFSIKMRIPTWVGSQFVPGKLYSYVDNNSKAWELYINDKKVGNLSFKKGEVSLDK
GFVSISRKWKKGDKVELKLPMPVRFSHAINEVKADNGRVAISRGPLVYCAEGIDNTEDVN
RYYLTKVSTDAKVQRDDTGILKGIDLIKNVSADYIDVKGNIHQASLNLIPYYAWNNRGVS
TMDIWFAENEKKVRESVAILPVAIKDIKATYTNEGENVFSIVDGKHPKNSKDTEVYRWTS
WNKKGEKQSIDFTFEKPTDIKAFSVYWYDDNGGVRLPDVWNLEYKDDSGSWKPFPLYSTD
SYSLLKDQFNLVHSDGDSFVVESIRLNVTPKADSAVGVLQVRFDIK

Enzyme Prediction     

No EC number prediction in MGYG000003362_01342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	31	589	2.1e-177	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.71e-148	30	589	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.72e-135	20	670	1	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIA99612.1	0.0	14	826	23	829
SCD19473.1	0.0	20	824	24	821
QJE94520.1	1.93e-290	11	826	15	821
BBO34810.1	9.59e-290	23	821	27	822
QDV74096.1	1.97e-287	26	820	42	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.68e-173	23	665	7	622	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	5.06e-127	31	668	16	647	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.29e-122	31	668	16	647	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	2.49e-99	31	665	3	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	3.29e-99	31	665	3	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.36e-98	31	665	3	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000918	0.998151	0.000319	0.000191	0.000187	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003362_01342.