CAZyme Information: MGYG000003362_01852

Basic Information

• Species: Dysgonomonas sp900079735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900079735
• CAZyme ID: MGYG000003362_01852
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835	MGYG000003362_10|CGC2	95699.83	5.9989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003362	3888864	MAG	United States	North America

• Gene Location: Start: 81517; End: 84024 Strand: +

Full Sequence      

MKYIIYLITSMFIMSACINQKNLNKSPVSLMWEMGRNGIEPGYYENTFYLINHSNDSLRG
NWIIYYNQMPAAVKPEPTSPVIVQQISSTYYKIAPSSSYRPLASGDTLKITFRCAGSILK
NAGAPEGAYIVMLDEKGKESVPYSVAINSKPFLHDYQWSRVGESELPYPDGKIVYESNLI
FSEQVPLKKTDIFPSLKNVKENGGEFSFTKDVSLKYDPTFANEANLLKEKLEKLYGCNIV
DKAAVTINLRKESYVGKNKEYYQMELNNGSIEITGNTPHAIFNGVQTLLAFIHSKDLPYS
LPNVSISDYPDLEYRGQMLDVARNFSSKENILKLIDLLSMYKMSVLHLHLTDDEGWRIEI
PGLEELTTVGARRGHTLYEKECLYPAYGSGWDANDENSIGNGYFTRSDFIEILKYAQKHH
IRVIPEIDLPGHARAAIKAMNARYYKYIKSDKKKAEEYLLTDFADTSRYISAQSYTDNVI
NVALPSVYSFVKKVVNEVDLMYKDAGMELSVLHLGGDEVPHGAWEGSDIAMTFMKEKGFK
ETRELKDYFIEQIIPFFKEKNIQLGAWQEVGLLPDETVNKKFSEDNVLSYCWNTVPEWNG
DEIPYRLANAGYPIILCNVTNLYFDLSYNKHENEPGVYWGGFVNEYNSFNVVPYDIYKSV
RSDMSGNRIDITKVSNKKIALSPNAYNEIKGMQGQLWAETIRNFDMVEYYLFPKMFGLIE
RAWNTHPEWENEPLSDKYTNALRLYNRKIGEYELPRLSHLNIKFRIAHPGIEMIDDKLHV
NTSIPNAEIRYTIDGSEPTVNSTLWTEPITCNAKEIRAKAFYCGRESVTTLYKYK

Enzyme Prediction     

No EC number prediction in MGYG000003362_01852.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	313	725	9.3e-92	0.9554896142433235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	0.0	308	733	1	425	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	3.25e-109	313	731	2	352	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.05e-104	313	723	2	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	9.17e-93	181	809	121	689	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	2.20e-53	313	731	2	324	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73869.1	0.0	1	829	1	831
CBK66887.1	2.23e-314	17	831	10	828
QRN00147.1	3.07e-314	17	831	19	837
QUT25549.1	6.16e-314	17	831	19	837
QDH52947.1	6.16e-314	17	831	19	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	1.08e-92	47	797	42	823	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	2.08e-92	47	797	42	823	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	1.07e-91	47	797	42	823	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	1.69e-63	192	729	142	616	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	2.02e-62	192	729	139	613	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04786	1.25e-99	44	818	41	841	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P13670	1.90e-96	50	795	71	846	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
Q54468	1.37e-91	47	797	69	850	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P49007	2.02e-88	43	730	54	732	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P96155	2.04e-58	192	725	141	607	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000036	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003362_01852.