CAZyme Information: MGYG000003362_02212

Basic Information

• Species: Dysgonomonas sp900079735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900079735
• CAZyme ID: MGYG000003362_02212
• CAZy Family: GH144
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722	MGYG000003362_14|CGC4	83388.13	5.8585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003362	3888864	MAG	United States	North America

• Gene Location: Start: 87971; End: 90139 Strand: +

Full Sequence      

MKLRIIFCLLVIRCLSAPAQEPEYDHIFFDNGLMTGRYYYSKADYTSPSYIQNIENKLPV
SEKEYFTAKNSLLLNYVSAPNGSWSASIIYHDWRGKDFVKEGKSLDFKLFIKSGTEAGEL
PLIAIGAINKKETTTSSFINLNDYISQFKQEEWVSVSIPLSEFKNLSYTNTKEIKEVLFK
QNSQDGKEHTLYIDQVELSPIQKPVSDVIVPAIKAKAYERHVDLWWDKSGLENIKYIKIY
RSEDGREFKQVGIQYPYTGRYADFTNEPNKTFSYRIACVNYDYSESQPSNIVESTTRYMT
DEQLLDMVQEASFRYYWDGAEPNSGLALENIPGRRNMIATGASGFGMMAIVTGVERGYIT
REEAIQRFKKIVAFLDKAETFHGGYAHFIDGTTGKVEPFFGMRDNGADMVETSFLFQGLL
TVRQYFDKNSDDEKYIRNTITKLWKNIEWDWFKKTKDSKYLYWHWSPDQEWVINHNLIGW
NETMITYLLAIASPTHGIGKDMYYSGWASQEKLAQDYRADWGQTRDGAMYSNGNTYFGVK
LDVGVSNGGPLFFIHYSYLGLDPHKIKDKYVSENYFENFRNIALINYRYCVENPKKNIGY
GVDNWGLTASDGPWGYRAAEPVDHQDVGTMAPTGALASFPYLPEQSMAALKNYYRNYGSF
LWGEYGFRDAFNLNENWCANIYMGLNQAPVTVMIENYRTGLIWNLFMKDPDVQRMVKEVF
IK

Enzyme Prediction     

No EC number prediction in MGYG000003362_02212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH144	299	718	2.1e-166	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5368	COG5368	4.35e-100	301	714	10	423	Uncharacterized protein [Function unknown].
pfam10091	Glycoamylase	2.33e-76	474	710	1	215	Putative glucoamylase. The structure of UniProt:Q5LIB7 has an alpha/alpha toroid fold and is similar structurally to a number of glucoamylases. Most of these structural homologs are glucoamylases, involved in breaking down complex sugars (e.g. starch). The biologically relevant state is likely to be monomeric. The putative active site is located at the centre of the toroid with a well defined large cavity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EFK64929.1	3.32e-313	9	719	6	717
QIX65029.1	3.32e-313	9	719	6	717
EFI10069.1	3.32e-313	9	719	6	717
QUT97401.1	4.70e-313	9	719	6	717
QUT52134.1	4.70e-313	9	719	6	717

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z06_A	1.17e-312	21	719	3	700	Crystalstructure of beta-1,2-glucanase from Parabacteroides distasonis [Parabacteroides distasonis ATCC 8503],5Z06_B Crystal structure of beta-1,2-glucanase from Parabacteroides distasonis [Parabacteroides distasonis ATCC 8503]
5GZH_A	3.53e-133	284	719	9	433	Endo-beta-1,2-glucanasefrom Chitinophaga pinensis - ligand free form [Chitinophaga pinensis DSM 2588],5GZH_B Endo-beta-1,2-glucanase from Chitinophaga pinensis - ligand free form [Chitinophaga pinensis DSM 2588]
5GZK_A	3.71e-133	273	719	19	453	Endo-beta-1,2-glucanasefrom Chitinophaga pinensis - sophorotriose and glucose complex [Chitinophaga pinensis DSM 2588],5GZK_B Endo-beta-1,2-glucanase from Chitinophaga pinensis - sophorotriose and glucose complex [Chitinophaga pinensis DSM 2588]
4GL3_A	2.15e-130	288	719	5	413	Crystalstructure of a putative glucoamylase (BACUNI_03963) from Bacteroides uniformis ATCC 8492 at 2.01 A resolution [Bacteroides uniformis ATCC 8492]
4QT9_A	1.19e-124	285	713	5	421	Crystalstructure of a putative glucoamylase (BACCAC_03554) from Bacteroides caccae ATCC 43185 at 2.05 A resolution [Bacteroides caccae ATCC 43185],4QT9_B Crystal structure of a putative glucoamylase (BACCAC_03554) from Bacteroides caccae ATCC 43185 at 2.05 A resolution [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6LGF6	7.66e-313	9	719	6	717	Exo beta-1,2-glucooligosaccharide sophorohydrolase (non-reducing end) OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_3064 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000317	0.999057	0.000200	0.000147	0.000137	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003362_02212.