CAZyme Information: MGYG000003362_03118

Basic Information

• Species: Dysgonomonas sp900079735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900079735
• CAZyme ID: MGYG000003362_03118
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000003362_23|CGC1	49963.15	6.3456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003362	3888864	MAG	United States	North America

• Gene Location: Start: 99191; End: 100465 Strand: +

Full Sequence      

MSKRNYNIKTMRKLFYLLPLLIIFLSCQSKMEEKQSSDRFIRVEGPNLIKPDGKKFLIQG
INLGNWLNPEGYMFFFQDASSYRLINEAFCEMVGPDFTNWFWNEFKKNYITEEDIKYIKQ
TGMNSVRIPFHYKLFTNEDYMGQASDHNGFGMIDQVVEWCRQEGLYVILDMHDAPGGQTG
DNIDDSYGYPWLMESEPSKELFCNIWKKVAEHYANDTIILGYDLLNEPIAHYFLEEYAHL
NDSLEPLYKRCVDTIRMVDKNHIVLLGGAQWNGNFKVFKDSKFDDKLMYTCHRYWCDTLQ
SNIQDFVQFRDSVNLPIYMGETGENTDQWIAGWTRLMERNNIGWHYWPYKKMVPNSCMVT
IPKPENWDLIVEYTKQDRGNFAKIRAARPNQEVVKKAMTDLLENMKFKHCTKNAGYISAL
GMKP

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	98	352	4.4e-102	0.980544747081712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.23e-36	98	347	17	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.03e-24	94	329	64	285	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIA99600.1	7.09e-286	11	424	1	414
AIA99611.1	1.04e-269	11	424	1	415
QIK53840.1	5.94e-264	11	424	1	413
QIK59288.1	5.67e-262	11	424	1	413
BBE18442.1	1.30e-222	8	424	2	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.15e-24	60	352	7	318	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	2.94e-24	60	352	7	318	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
1EQP_A	9.26e-17	57	295	8	273	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	3.01e-16	57	295	8	273	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	3.11e-16	57	295	13	278	Thestructure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	1.07e-33	40	294	3	248	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
A3DJ77	2.45e-24	60	352	7	318	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	2.45e-24	60	352	7	318	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	1.96e-22	60	352	7	318	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	5.38e-21	57	294	7	202	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000017	0.000595	0.999429	0.000004	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003362_03118.