CAZyme Information: MGYG000003363_00224

Basic Information

• Species: Bacteroides sp900766195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766195
• CAZyme ID: MGYG000003363_00224
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000003363_6|CGC2	53350.41	7.3869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003363	4177575	MAG	United States	North America

• Gene Location: Start: 45416; End: 46825 Strand: -

Full Sequence      

MMYKLSKFLFFSLLFFVETISMSAQKNVVAAFPIEVKTPVRPAGQEDVLNLVTAKLDTVR
VGFIGLGMRGPSAVERWTHIPGTKIVALCDLRSECVEKSQKILTKAGLPKAATYSDSEDA
WKRLCERPDIDVVYIATDWKHHAEMGVYAMEHGKHVAIEVPAAMTIAEIWKLINTSEKTR
KHCIQLENCVYDFFELTTLNMAQQGVFGEVLHVEGSYIHNLEDFWPYYWNNWRMDYNRAH
RGDVYATHGLGPACQLLDIHRGDRMKFLVAMDTKAVNGPAYIKKHSGEIVTDFQNGDQTS
TLIRTEKGKTILIQHNVMTPRPYSRMYQVVGVEGYASKYPVEEYCLRPSQVDSKDVPNHE
NLNAHGSVPEEIKKALMEKYKHPIHRELEETAKKVGGHGGMDYIMDYRLVYCLRNGLPLD
MDVYDLAEWCCMAELTGLSIKNNSVSVAIPDFTRGGWNKIKGYRHAFVK

Enzyme Prediction     

No EC number prediction in MGYG000003363_00224.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	55	459	2.3e-163	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.27e-19	58	360	3	281	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.33e-13	59	184	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	9.59e-08	59	171	18	145	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK11579	PRK11579	1.07e-06	57	233	3	164	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT74312.1	2.44e-293	33	469	33	469
QRQ59139.1	2.44e-293	33	469	33	469
ALJ49109.1	2.44e-293	33	469	33	469
QDM12758.1	2.44e-293	33	469	33	469
QUT83076.1	2.44e-293	33	469	33	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.27e-88	41	457	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	5.13e-67	59	461	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
4H3V_A	1.27e-10	61	242	9	190	ChainA, Oxidoreductase domain protein [Kribbella flavida DSM 17836],4H3V_B Chain B, Oxidoreductase domain protein [Kribbella flavida DSM 17836]
4FB5_A	9.22e-09	50	250	17	215	Crystalstructure of a probable oxidoreduxtase protein [Rhizobium etli CFN 42],4FB5_B Crystal structure of a probable oxidoreduxtase protein [Rhizobium etli CFN 42]
3E82_A	6.12e-08	57	217	6	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZX8	1.24e-291	24	469	22	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	6.11e-289	33	469	28	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	6.11e-289	33	469	28	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q7MWF4	1.32e-277	21	469	20	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
A6KX96	2.85e-268	33	469	35	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000393	0.998913	0.000188	0.000170	0.000160	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003363_00224.