CAZyme Information: MGYG000003363_00648

Basic Information

• Species: Bacteroides sp900766195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766195
• CAZyme ID: MGYG000003363_00648
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	MGYG000003363_19|CGC1	85785.85	7.072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003363	4177575	MAG	United States	North America

• Gene Location: Start: 31128; End: 33446 Strand: -

Full Sequence      

MKKIRILLTILILSTNIAVAQQKNDYKNPKLPTKDRVSNLISQMTLEEKIGQMDMFATWS
LDAYKNSKELIRIGIGAWIIPVATAKEVNEIQKLSEKTRLKIPFLMGTDAAHGNAMSPRR
TIFPTSISMAATFNPYLLHKTYKVTAQEVRSNGVHWTFAPSVDIVHDARWGRTGETYGED
PFLSSTLVREAVKAMQNYDDPQLRLAACAKHMVGGGASVGGINHANAEISERMLRSYFMP
PYQAAIEEGIYTIMPGHNDVNGIPCHTNKWLLEDIVRKEYGFNGFYITDMGDLENLFTMH
HTAENQKDALKQGINAGIDMHMNSDSIGQFITPMMQLVKEGKISEETINDAVARILTVKF
NLGLFENRYVDEKKQNEDYSHKESKQLALDAARQSIILLKNSGNLLPLDKKKYKKILVTG
PNANNQALLGDWSFTQPAGHVTTVLQGIQDYVGTNTEVVFSYSGRLKAKKSNVVVNTTDP
TTQLKNLEDGGELNDYAIQDAANKAKDCDLAIVAVGGYGNRTDWGYRTYGESADRPSIDF
YGRQEELIREIAATGIPVIVVLINGNPINNTWVTKNIPTIIDIFEPGMFGGKALAEILFG
DINPSGKLPVTVPQSAGQIPLYYYQTASRYKTGYGLGSSRADDKPAFAFGHGLSYTTFDY
TNPRVNSTSMEKDKDVIVTVDVTNSGQKAGYETVMCFVNDEVSSVVTPIHLLKGFNKIWL
EPSETKSVTITIPFKEFGLWNQDMKYVVEPGKFNLKIGSASDDIKHVIKLVF

Enzyme Prediction     

No EC number prediction in MGYG000003363_00648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	96	322	2.6e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.28e-176	28	766	26	759	beta-glucosidase BglX.
COG1472	BglX	2.63e-99	44	457	1	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.11e-81	28	766	44	773	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	4.71e-73	45	358	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	4.20e-58	396	655	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP57287.1	0.0	1	765	1	760
ASM65975.1	0.0	1	765	1	760
QQT77469.1	0.0	1	765	1	760
QUU08173.1	0.0	1	765	1	760
QCQ49054.1	1.41e-313	26	765	31	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z9S_A	6.75e-135	14	765	5	781	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5Z87_A	1.58e-128	18	765	28	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.87e-126	37	765	14	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.02e-125	37	765	14	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5P_A	4.28e-121	28	761	29	754	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.93e-145	7	767	6	718	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.34e-132	37	765	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.21e-130	37	765	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	4.67e-126	22	765	25	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	6.00e-119	28	764	26	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000548	0.998638	0.000266	0.000183	0.000176	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003363_00648.