CAZyme Information: MGYG000003363_01071

Basic Information

• Species: Bacteroides sp900766195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766195
• CAZyme ID: MGYG000003363_01071
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	MGYG000003363_40|CGC1	29779.28	7.6316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003363	4177575	MAG	United States	North America

• Gene Location: Start: 45845; End: 46627 Strand: -

Full Sequence      

MKRCFIVSLLCFLWSMMPGLIQAQDPDMLPPPASPEEAKVYHIPEVDSIPLGYSIEDENI
LDFCGQLIDLNMHGRKRKLGRELASLSHYSSKLVQRANFYFPLVEPILYQNGIPDDFKYL
MMIESGLDPNACSGKGAAGLWQLMKGTAGDCGLTVNDGVDERFHIEKATQAACRYLKNAY
RRFGNWVAVAQSYNIGPERVATELTRQQVDDPLELRLVEETNRYTYRIFAAKIIFTHPKN
FGINENMLYYKKIRGYSRYR

Enzyme Prediction     

No EC number prediction in MGYG000003363_01071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	100	231	4.9e-23	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	6.13e-53	110	233	3	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	1.27e-22	114	200	12	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	3.45e-18	120	231	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.61e-13	96	260	135	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK10783	mltD	8.64e-13	105	244	102	253	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42036.1	1.41e-120	1	257	1	257
AND21743.1	6.48e-71	54	242	54	245
QJR57517.1	6.48e-71	54	242	54	245
QJR70601.1	6.48e-71	54	242	54	245
AII66785.1	6.48e-71	54	242	54	245

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.36e-14	57	243	56	249	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.36e-14	57	243	56	249	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000384	0.998843	0.000206	0.000188	0.000178	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003363_01071.