CAZyme Information: MGYG000003363_01335

Basic Information

• Species: Bacteroides sp900766195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766195
• CAZyme ID: MGYG000003363_01335
• CAZy Family: GH65
• CAZyme Description: Kojibiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676	MGYG000003363_55|CGC1	76417.98	7.1202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003363	4177575	MAG	United States	North America

• Gene Location: Start: 9896; End: 11926 Strand: +

Full Sequence      

MKRYICYILILLATNTFAQDPWNIKTSHINSENYYGVTVANGMMGIVSSSEPLRTSKIIL
AGSYDKYGRGGVSNFLDGYNMLNLTLSIDGQTIRMDNIDSYTQELDMKESIHRSSFRFGN
KAEVTYSFAALRQLPYSAILMVEITPHADIVINATNIHEIPDAFRDGQMYYNEINRKHAS
VKLMSTKAMSPTKKLEICASTSFLFPERAGNEPRVIHSTPNNNSHNMKFSKTLKSGEKYR
FCIVGSILTTAHHPDPMNEAERLTIFANLEGCDRLLQIHKQQWSELWLSDIKIEGDAQSQ
QDIRSMIYHLYSFVREGSSLSISPMGLSGLGYNGHIFWDADTWIFPTLLMLQPKLAESLI
NYRYNRLEAAKQNAFEHGYKGAMFPWESSDSGFEETPVWALAGTFEHHISGCVALAAWNY
YRVTQDKAWLKEKGFPILEATANFWLSRAEYDSVGKAHIKNVVAADEWAENVDDDAYTNG
VAKANLLAAVQAARILKQPENPNWGKLASQLSFYQFADGVTKEHYTYNGESIKQADVNLL
AYPLELISDQQQIKKDLEYYAVRVPKKNTPAMTQAIFSLLYARLGEADKAWYFFQDAYIP
NLNPPFRVISETQEGRNPYFVTGAGGILQSVLMGFGGLNITDNGIKQLKSTILPPHWKKL
ILKGIGVKREEFLIQK

Enzyme Prediction     

No EC number prediction in MGYG000003363_01335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	304	642	3.8e-102	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	2.53e-103	17	660	6	718	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	2.45e-70	307	645	4	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	2.82e-53	1	659	1	706	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	1.17e-07	38	241	18	231	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI82226.1	0.0	1	673	1	673
QGW26879.1	2.56e-309	9	675	11	678
AFD05259.1	8.06e-307	1	674	12	688
QEC67782.1	5.22e-306	10	675	12	676
QEC55496.1	7.97e-305	1	675	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	3.40e-267	19	674	21	676	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	2.18e-59	18	660	4	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	2.02e-33	17	665	5	714	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTR_A	1.55e-31	80	674	78	731	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTP_A	2.75e-31	80	674	78	731	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	2.79e-78	230	645	210	632	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q8L163	5.90e-72	13	663	10	735	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
Q8RBL8	1.31e-62	19	676	20	753	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1
A0JMP0	1.64e-58	279	665	186	585	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
F1NZI4	1.81e-58	279	666	241	638	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999008	0.000196	0.000165	0.000162	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003363_01335.