CAZyme Information: MGYG000003363_01447

Basic Information

• Species: Bacteroides sp900766195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766195
• CAZyme ID: MGYG000003363_01447
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		83000.7	6.0999

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003363	4177575	MAG	United States	North America

• Gene Location: Start: 13510; End: 15756 Strand: +

Full Sequence      

MNLLSLMTVEEKTCQLATLYGYGRVLNDSLPTSNWSNEIWKDGIANIDEMLNGVGRKSKN
VSNLLYPFSNHAKAINTVQRWFIEKTRLGIPVDFTNEGIHGLNHTKATPLPAPIGVGSTW
NKALVRSAGEIIGKEAKALGYTNVYAPILDVVRDPRWGRTLECYGEDPYLIASLGKEMVN
GIQSNGVASTLKHFAVYSVPKGGRDGDARTDPHVAPRELHQLHLYPFKAVIQSAHPLGIM
SSYNDWDGVPITSSYYFLTELLRQEFGFDGYVVSDSGAVEFVESKHHVADTYDEAVRQVL
EAGLNVRTNFTSPADFILPIRRLVQEKKLPLEVLDKRVAEVLNVKFRLGLFDHPYVDVKE
TDNIRGIEQNIDFVRQIQREALVLLKNKDNILPLDKNKLKRILITGPLADESNFMISRYG
PNQLETITLLQGIKGYLKGLDTKIEYAKGCDVVNEGWPATEIMPTLMNDLEKKGIADAVE
KAKTSDVIIAVLGEDELSVGESRSRTSLELPGRQQQLLEALYATGKPVILVLINGRPLTI
NWADANIPAILEAWFTNSQGGQVIAETLFGDYNPGGKLTVTFPKSIGQIELNFPFKKGSH
GGQPNTGPNGAGSTRVQGELYPFGYGLSYTTFRYSDLEVAPLKQSIKGDYTVKVNVTNTG
KRAGDEIVQLYVRDKVSSVVTYDSELRGFERVFLQPGETKLVTFTLKPEDLQLLGRDMHW
VVEPGEFEIMIGASSQDIRLKETITALP

Enzyme Prediction     

No EC number prediction in MGYG000003363_01447.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	84	306	6.2e-68	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	2	739	40	758	beta-glucosidase BglX.
PLN03080	PLN03080	4.62e-86	66	708	40	744	Probable beta-xylosidase; Provisional
COG1472	BglX	9.83e-83	68	452	38	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.83e-67	382	629	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.95e-60	8	344	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63350.1	0.0	2	748	58	804
QBN20400.1	0.0	2	748	58	810
AOW08795.1	0.0	2	748	58	805
ALJ60238.1	0.0	2	741	63	797
CDF78704.1	0.0	2	747	56	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.25e-136	3	739	17	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.79e-135	3	739	17	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	4.62e-133	75	739	68	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	2.41e-127	70	739	103	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	2.81e-127	2	739	20	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.42e-139	87	741	62	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	7.95e-131	75	742	89	761	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.54e-126	2	739	40	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	1.90e-120	3	739	43	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	4.00e-102	7	743	46	773	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003363_01447.