CAZyme Information: MGYG000003363_01928

Basic Information

• Species: Bacteroides sp900766195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766195
• CAZyme ID: MGYG000003363_01928
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000003363_98|CGC1	36626.7	7.7841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003363	4177575	MAG	United States	North America

• Gene Location: Start: 63281; End: 64252 Strand: +

Full Sequence      

MKKSVIRNLCLFLIAQIVCALNLSAGNQWKDTIVVSRDGSGDYRTLTEAMEGIRAFMDYK
VTVRVKNGIYKEKLIVPSWLENVEFIGEDVDKTIITYDDHANINKMGTFRTYTVKVEGNS
ITFRNLTIENNAAQLGQAVALHTEGDKLIFIGCRFLGNQDTIYTGLKGTRLYFQNCYIEG
TTDFIFGPSTALFEDCTINSKRNSYVTAASTPQDVEVGYVFKHCKLIADPGVDKVYLGRP
WRPYAFTLFIDCEMGKHICTSGWDNWRNPENEKTVRYGEYGSTGEGASGERVKWARELSR
KEALKYSNPEFIFKQCSSWIPSK

Enzyme Prediction     

No EC number prediction in MGYG000003363_01928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	33	312	2.7e-98	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.66e-72	35	312	9	296	pectinesterase
pfam01095	Pectinesterase	1.73e-72	33	312	2	295	Pectinesterase.
PLN02682	PLN02682	6.81e-70	32	321	70	368	pectinesterase family protein
COG4677	PemB	2.64e-68	31	309	81	399	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02708	PLN02708	3.70e-64	35	321	245	550	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69178.1	1.55e-183	17	323	15	322
QRQ48638.1	2.06e-170	3	319	2	319
QUT45769.1	5.11e-170	9	319	4	315
ALJ61263.1	8.62e-167	17	321	15	320
QUT93208.1	8.62e-167	17	321	15	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.74e-43	33	294	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.38e-39	34	294	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.14e-31	33	299	11	278	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.99e-31	33	299	11	278	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	8.98e-26	34	322	7	340	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.13e-57	35	312	9	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	9.52e-55	30	313	79	373	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LXD9	6.81e-53	21	319	229	546	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q8GXA1	3.43e-52	30	321	255	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8GX86	7.45e-52	30	323	253	557	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.029042	0.431778	0.538424	0.000226	0.000219	0.000290

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003363_01928.