CAZyme Information: MGYG000003363_02352

Basic Information

• Species: Bacteroides sp900766195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766195
• CAZyme ID: MGYG000003363_02352
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741	MGYG000003363_116|CGC1	84738.5	6.3891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003363	4177575	MAG	United States	North America

• Gene Location: Start: 44471; End: 46696 Strand: +

Full Sequence      

MRRTFLSILYLNAIILLGINFASCKSEEIEGSYIQLAEKSYTFPIKGETRTIDVSTNIQN
ITAYSPNQEDWATFSYEKGKLTVTTKDNNTNSERKMTIWLKGAGTTTLFDITQYSWQSSV
NHLAKDIKLKVKDGSASSQQSDDSGIKESYDGDINTMYHSKWDKSDLPITLTYNFEGINT
MDYILYNPRPTGTNGNFQEFDLYIATESSKEYKKYGSYNFNGSSAVSIIKFESPIEKPTS
IKFVVNSGTEGYVSCAEMEFYQKNPVDFNELSIFTDKTCSELKPGLDRKAIDEIKVELYR
NIAIDLFKNRIDRKDFRVQEYKSWIHPDIQAKINKTAPYSLRDNPTGIVAIGKESLILLA
DNIGNKNVTLSFVDAQDVTNMGGKSYFLKDGLNVITPDNDGLIYIMYHTRTGTEQPVKIN
FVTGKVNGYFDSQKHKKEDWKSLLSQATYGIFDLVGKYAHMTFQTEAFRQYTPDGMGLIN
KYDDIVRLEQEFMGVLGTDKQFKNRMYLAVSNSGYMYASSYHTGYNVSTQSRILNKDQDP
SDFDSWWGPAHEIGHVNQTRPGLKWIGMGEVTNNIFSQMIVESFGLETRLSRRNFYASAR
QKFFVNKEPHNLRNIGDDVMDKLVPFWQLKLYMHNVLGKNDFYPKVFEKVRINPNPATSA
KCQIEFVKICCDVAQLDLTSFFENSGFLTPIDTEIDDYGKEQFTITQSEIDACKQYITSK
NYPKPQHDFSLITDKTVNNFK

Enzyme Prediction     

No EC number prediction in MGYG000003363_02352.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	2.52e-48	424	683	1	265	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
cd14948	BACON	2.83e-09	33	113	1	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam00754	F5_F8_type_C	1.33e-04	151	260	19	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT79445.1	1.25e-180	34	741	118	860
QRP89238.1	1.25e-180	34	741	118	860
QUU03487.1	1.77e-180	34	741	118	860
QRM71921.1	3.90e-179	34	741	118	860
QTO25368.1	3.90e-179	34	741	118	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SCI_A	1.78e-70	269	734	10	487	ChainA, Peptidase M60 domain-containing protein [Akkermansia muciniphila ATCC BAA-835]
5KD2_A	2.98e-61	266	740	27	513	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5KD5_A	3.16e-56	314	740	28	465	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]
5EV7_A	4.05e-30	345	734	45	407	Thecrystal structure of a functionally unknown conserved protein mutant from Bacillus anthracis str. Ames [Bacillus anthracis str. Ames]
4FCA_A	1.80e-28	345	734	45	407	Thecrystal structure of a functionally unknown conserved protein from Bacillus anthracis str. Ames. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000439	0.061251	0.938077	0.000079	0.000085	0.000063

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003363_02352.