CAZyme Information: MGYG000003367_00227

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_00227
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000003367_6|CGC1	48178.44	8.7971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 86524; End: 87774 Strand: -

Full Sequence      

MKITSLCLLNQSLYICLITPENKTILENFVYTLDWVIYVLFTFSVIYLFIFSVASLLRKP
QKPSVAKEYRRIAILIAAYREDNVIQDTVKACLAQEYPHEKFDIVVISDHMTAETNAVLK
TYPIKLLQVDFEKSTNTKSLKAALSYLEQDHYDIALILDADNYVNTTYLADINDAFAQPG
VEVVQTHRVAKNLNTDMAYLDGISEEINNSIFRMGHINLGMSAALIGSGMAFHYPIFYAA
MMDNQSLGGFDRVLEMKLLYNRVFFHYLPDTYVYDEKIQKSESFFLQRRRWLSAQYYSLL
EFARKLPIAILQRKWDFCDKLYQQASFSRVLLLGLIFVFAIFLSFATPALAYKWWITFGV
LLMALALAIPRRLWTVRMIKAIMLVPYSFILMFANLFYIKSANKKFIHTTHGVDNK

Enzyme Prediction     

No EC number prediction in MGYG000003367_00227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	71	292	2.8e-20	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	5.82e-23	74	233	1	163	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	1.09e-21	74	232	1	161	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.30e-20	17	376	1	365	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	4.81e-19	70	292	2	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	1.94e-14	45	184	3	142	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT91842.1	5.87e-191	26	414	1	389
ALJ62421.1	5.87e-191	26	414	1	389
ADV44010.1	4.46e-181	26	414	1	389
QRQ47856.1	2.60e-178	26	413	1	389
QUT47279.1	2.04e-170	47	413	2	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	2.33e-06	67	170	10	111	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	3.15e-07	67	302	46	287	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999899	0.000158	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
35	57
219	241
325	347
354	376
381	399