CAZyme Information: MGYG000003367_00443

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_00443
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000003367_13|CGC3	45861.45	8.6126

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 160421; End: 161641 Strand: +

Full Sequence      

MEKKLFDSTFRIAAKVVTICLISTNAFAQQALWNNTDIISPKINADKSVTFRIKAPKAIK
IEVEGDFLPPQKIETPFGVMEGTGKSELKEAKDGVWEYTSSPLASELYNYSFIVDGQKMN
DPDNVYLVRDVSTVTNYFLIPEGRADGYSVQNVPHGNLSKVWYASPTLGMKQRRMTIYTP
AEYYNTNKKYPVLYLLHGAGGDENSWSELGRAAQILDNLIAQGKAKPMIVVMPNGNGSEE
AAPGEAPNSMVKPTMMVPKMMDGSIEKAFPDVMKYVEKHYRTLSDKKGRAICGLSMGGFH
SLYISALYPDKFDYVGLFSAAIHAQSKGENTDVYDNMDRKLATQFGKAPKLYWIGIGKTD
FLYKDNTDFRKKLDEKHYPYTYMETDGGHIWRNWRIYLTEFAQKLF

Enzyme Prediction     

No EC number prediction in MGYG000003367_00443.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	165	403	1.6e-58	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	5.92e-31	147	406	58	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	1.15e-30	47	141	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG0627	FrmB	6.51e-23	176	395	38	298	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	7.58e-23	165	395	1	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	2.26e-09	48	122	2	60	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX64683.1	2.86e-181	21	406	12	396
QUR47977.1	2.86e-181	21	406	12	396
ABR44406.1	2.86e-181	21	406	12	396
QRO15451.1	2.86e-181	21	406	12	396
ADY36651.1	4.06e-181	21	406	12	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	5.71e-96	38	406	22	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	2.49e-61	41	406	40	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	2.30e-47	41	406	19	358	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	3.83e-47	41	406	40	379	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6RZO_A	1.87e-43	41	406	17	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	1.47e-35	42	406	42	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	1.48e-35	41	406	329	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.70e-28	41	406	395	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	5.38e-26	140	403	31	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P9WM38	4.80e-13	99	392	114	428	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000416	0.998675	0.000307	0.000196	0.000194	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_00443.