CAZyme Information: MGYG000003367_00548

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_00548
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	MGYG000003367_17|CGC1	40103.44	7.6185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 34364; End: 35410 Strand: -

Full Sequence      

MCGQETESYKEKQPYKNWVKMAPKFDDAFFKTAEAVRIADNVLLYQQVTGGWPKNIYMPA
ELSQQELEDVLAAKNDVNESTIDNTATTTEICYLSRIYLATNTTKYRDAAIEGIHYLLKA
QYENGGWPQFWPRPKPYYTHITYNDNAMVNVMELLREVSQKKAPYSYISDSLATSARNAF
DKGIDCILKTQVKINGKLTVWCAQHDEHTLLPAKARAYELPSLSGQESDDIVLLLMSLPH
PSKAVIEAVESAIAWYKASKIEGQQKEYFTNSEGKKDFRMVSCTNCEPLWARFYTLEDNR
PFFSDRDGVKKYNISEIGYERRNGYSWYNNSGLKVLKYYDKWKKALSK

Enzyme Prediction     

No EC number prediction in MGYG000003367_00548.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	46	334	2.2e-119	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	7.41e-159	46	336	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	1.26e-146	46	336	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69049.1	1.96e-205	1	348	17	364
ALJ61046.1	2.03e-205	1	344	17	360
QUT93421.1	8.27e-205	1	344	17	360
QRQ48738.1	7.25e-195	3	346	19	366
QUT45489.1	7.25e-195	3	346	19	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	3.65e-67	28	344	76	406	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	3.93e-66	14	341	20	328	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	6.17e-65	14	341	20	328	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_00548.