CAZyme Information: MGYG000003367_00605

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_00605
• CAZy Family: GH51
• CAZyme Description: Extracellular exo-alpha-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682	MGYG000003367_17|CGC4	77838.95	7.3142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 105930; End: 107978 Strand: +

Full Sequence      

MTNMTLKSLAFGIGLFWLIPFTYGSNTSVPDGTLYINKSKTHKVNPVKYGFHYEEIGMMG
EGALHAELVRNRSFEEATPPEGLSVKNGIYENIPAPRTKEKDVYTADPLIGWTTSPLSYA
PIFINRTNIDPMSDQNKYSMLVNVTGDITNYKNAMILNRGYYGMNFDANVSYKLSLFLKN
RNYSAPLRVFLVDERGSCVSNVVDFNLKDGAWAKYTAELKPEKKIERGMLAIQPLTKGQF
QVDVVSLFPSDTWNDGKSVFRKDIVQNLKDFAPSFIRFPGGCIVHGVNEETMYHWKETLG
PIENRPGKWSKWAPFYRTDGIGYHEFYELCEYVGADAMYVLPTGMICTGWVKQSSPWNFE
QPSVNLNDYIQDALDAIEYAIGDTTTVWGAKRAQNGHPKTFPLKYIEIGNEDFGPVYWER
YEKIYKALSAKYPNLIYIANSIIGKENDDKRKDIAHFPNPGNVKVFDEHFYQSIEWACRQ
HYRFDNYKRGVADIFIGELGIDGKYPYNLLATGAVRMSMERNGDLSPLFAERPVMRHWDF
MEHRITPLPMLIDGVNCSVKTSFFYLSKMFRDNTFDICVDASIKDMKGLQNIFVTMGYDT
AGKQYILKLINLQDKKVSLESNVLGFKHPVKAHQTSLVLSFGKENTPDNPNLVKPVESEV
TLDLNKSLELEPASMVIYRFKK

Enzyme Prediction     

No EC number prediction in MGYG000003367_00605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	239	681	6.7e-74	0.6825396825396826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	3.54e-30	242	415	33	177	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
pfam06964	Alpha-L-AF_C	5.28e-07	475	674	2	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	8.20e-05	507	661	18	174	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40001.1	0.0	1	681	1	685
QUT26336.1	0.0	1	681	1	685
QUR45433.1	0.0	1	681	1	685
QDH53533.1	0.0	1	681	1	685
SCV07204.1	0.0	1	680	1	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	6.10e-49	33	660	2	604	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
2VRK_A	2.16e-12	261	414	53	179	Structureof a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus],2VRK_B Structure of a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus],2VRK_C Structure of a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus]
4ATW_A	4.82e-12	260	414	49	175	Thecrystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_B The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_C The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_D The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_E The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_F The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8]
3S2C_A	4.85e-12	260	414	49	175	Structureof the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_B Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_C Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_D Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_E Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_F Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_G Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_H Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_I Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_J Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_K Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_L Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
2VRQ_A	5.01e-12	261	414	53	179	StructureOf An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_B Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_C Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	1.56e-62	18	576	21	542	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q8VZR2	7.64e-56	49	658	59	628	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
Q9SG80	5.43e-55	49	662	60	636	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
B8NKA3	2.23e-47	19	660	13	607	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
Q2U790	9.25e-46	19	660	13	607	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999041	0.000196	0.000155	0.000163	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_00605.