CAZyme Information: MGYG000003367_00705

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_00705
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000003367_19|CGC4	46730.43	8.624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 106457; End: 107674 Strand: +

Full Sequence      

MKSRLIGCGVLLLFAFTSWAQSKKVATNLPWSVRMVQSEMIRCPQSWQLDFQNTLKWDYC
HGLELQAMLDVYDVYADSSIFNYALAYADTMINDRGEIKTYKLAEYNIDRLNSGKFLFRI
YEETKNEKYKKALALLRSQLDTHPRNEDGGFWHKKIYPNQMWLDGLYMGAPFYAEYAYRN
NRVGDYPDVINQYITVARHTYDPKNGLYRHACDVSRKERWADPLTGQSQHCWGRAMGWYA
MAIVDALDFIPRHEAGRDSMLVILNNIALQLKRLQDPASGVWYQVLDRSGDKGNYLESSC
SSMFVYTLFKAVRKGYIDKSYLNVAIKGYKGLLNTFIEVDKNGLVSITKACAVAGLGGTD
YRMGDYDYYINEKIRSNDAKAVAPFIMASLEWERLEQVKTVVNQK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	394	8e-119	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.81e-124	31	395	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.10e-102	57	396	34	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69177.1	6.35e-250	22	405	23	406
QUT93209.1	1.49e-248	22	405	23	406
ALJ61262.1	1.49e-248	22	405	23	406
QUT77882.1	1.11e-239	22	397	23	398
AVM56437.1	3.57e-234	11	405	14	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.52e-115	57	395	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.25e-76	56	395	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.36e-75	56	395	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.80e-17	145	395	183	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	1.78e-16	40	333	48	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.78e-75	56	395	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.25e-42	168	391	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.25e-42	168	391	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000315	0.998962	0.000240	0.000164	0.000152	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_00705.