CAZyme Information: MGYG000003367_01001

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_01001
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000003367_26|CGC3	53246.88	8.2432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 94666; End: 96090 Strand: +

Full Sequence      

MVSRRDFLKTMTMASASLAVGSNGLLKASSLSNDQKPKSKSKVKIAYIGIGNRGEQIIGE
FARTGMVEVVALCDVDMGAKHTQKVMGMYPKAKQFRDFRQMFDKIGNEFDAVAIATPDHS
HFPITMLALASGKHVYVEKPLARTFYEAELLMQAARRHPQLATQVGNQGHSEANYFQFKA
WMDAGIIKDVTAVTAHMNNVRRWHKWDSNIYKLPAGQQIPADMDWNTWLGAAPYHEYNEK
YHLGDWRCWYDFGMGALGDWGAHILDTVHEFLELGLPYEVSMLYEKGHNDYFYPYSSTIL
FRFPQRKGMPPVDITWYDGLDNLPPIPAGYGVSGLDPNIPKTNQGDAPAAQLNPGKIIYS
KDLIFKGGTHGSTLSIIPEEKAKEMASKLPEVPKSPSNHFENFLLACNGLEKTRSPFEIN
GVLSQVFSLGVMAQRLNTQLFFDSRTKQITNNEFANAMLAGIPPRKGWEEFYKL

Enzyme Prediction     

No EC number prediction in MGYG000003367_01001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	40	193	4.5e-24	0.39348370927318294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.29e-28	42	304	3	227	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	5.22e-15	43	158	1	112	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
pfam19051	GFO_IDH_MocA_C2	1.52e-13	217	468	46	252	Oxidoreductase family, C-terminal alpha/beta domain. This entry represents a domain found at the C-terminus of a variety of oxidoreductase enzymes. The domain is related to pfam02894.
TIGR04380	myo_inos_iolG	7.19e-10	42	194	1	149	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
PRK11579	PRK11579	3.16e-09	62	203	25	163	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQT70232.1	3.07e-112	3	473	13	466
AEV99796.1	5.39e-14	3	167	4	193
BCS38310.1	5.68e-13	40	195	27	179
AXK36699.1	8.71e-13	2	214	6	236
ALG07302.1	4.89e-12	40	190	58	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EC7_A	2.64e-11	43	187	24	166	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
4GQA_A	7.48e-09	41	276	25	228	ChainA, NAD binding Oxidoreductase [Klebsiella pneumoniae 342],4GQA_B Chain B, NAD binding Oxidoreductase [Klebsiella pneumoniae 342],4GQA_C Chain C, NAD binding Oxidoreductase [Klebsiella pneumoniae 342],4GQA_D Chain D, NAD binding Oxidoreductase [Klebsiella pneumoniae 342]
7D5M_A	9.17e-08	43	204	12	177	ChainA, Oxidoreductase [Azotobacter vinelandii DJ]
7D5N_A	9.26e-08	43	204	12	177	ChainA, Oxidoreductase [Azotobacter vinelandii DJ],7D5N_B Chain B, Oxidoreductase [Azotobacter vinelandii DJ]
3C1A_A	1.19e-07	37	156	5	117	Crystalstructure of a putative oxidoreductase (ZP_00056571.1) from Magnetospirillum magnetotacticum MS-1 at 1.85 A resolution [Magnetospirillum magnetotacticum MS-1],3C1A_B Crystal structure of a putative oxidoreductase (ZP_00056571.1) from Magnetospirillum magnetotacticum MS-1 at 1.85 A resolution [Magnetospirillum magnetotacticum MS-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ECL7	3.90e-11	2	157	4	174	Alpha-N-acetylgalactosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagA PE=3 SV=1
A0KV43	9.14e-11	2	157	4	174	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain ANA-3) OX=94122 GN=Shewana3_1428 PE=3 SV=1
Q50HM6	9.92e-11	40	214	91	269	Glycosyl hydrolase family 109 protein OS=Streptomyces niveus OX=193462 PE=3 SV=1
A8H2K3	1.20e-10	2	211	3	242	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1
A9N564	1.27e-10	43	187	3	145	Inositol 2-dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=iolG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000001	0.000000	0.999913	0.000101	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_01001.