CAZyme Information: MGYG000003367_01002

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_01002
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000003367_26|CGC3	42624.12	9.1563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 96120; End: 97223 Strand: +

Full Sequence      

MRKTLFVLLLSLPFQLLLAQSNLLSNFPKGCSPEEVGKRLAFHFVDGKHMLHAGKWISYP
ETFNWSGALKFGAITKDKKLIQLLQDKFEPLFTTEKAFLPIMNHVDLNMFGSLPLELYRI
TKEKRYLDLGIPYANTQWEVPENANQEQKKWAEKGYSWQTRLWIDDMYMITIVQTQAYRI
TKDRKYIDRAAKEMVLYLDELQRPNGLFYHAPDVPFYWARGNGWVAAGMTELLSSLPKDH
KDRPRILRGYQVMMKSLKDYQTSNGLWNQLINESDCWAETSGSAMFTFALIKGVKNGWLD
AKEYAPVARKAWIGLVSYINDKDEVTEVCVGTNKKNDKQYYYDRPRHAGDYHGQAPYLWC
VAALLDK

Enzyme Prediction     

No EC number prediction in MGYG000003367_01002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	364	5.3e-74	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.03e-52	59	360	29	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.51e-45	59	358	36	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA52191.1	6.75e-221	1	367	1	367
QUT73021.1	6.75e-221	1	367	1	367
QUT40870.1	6.75e-221	1	367	1	367
ALJ39814.1	5.54e-220	1	367	1	367
QDH53377.1	1.85e-218	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	2.93e-35	162	362	199	408	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	5.92e-31	53	364	36	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.54e-30	53	364	26	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	2.03e-23	163	312	158	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.10e-20	163	312	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.24e-30	53	364	36	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	1.32e-17	124	325	131	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.79e-17	143	315	137	329	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.52e-16	163	341	201	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	1.28e-07	215	365	61	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000201	0.999183	0.000163	0.000148	0.000138	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_01002.