CAZyme Information: MGYG000003367_01006

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_01006
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000003367_26|CGC3	43379.11	9.0363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 104628; End: 105731 Strand: +

Full Sequence      

MRRILLVFFYFLPFQLLLAQTNVLGKFSKGYAPEEVGKRLSYHFLDMKHALYVGKWIGYY
ETFTWSGALKYAELTKDKKLIKLLQDKFNLLLTTEKAYLPPKNHVDLNTFGSLALELYQV
TKEERYKEIGLEYADSQWKVPEKVSQEQKIWAEKGYSWQTRLWIDDMYMIPILQVEAYKT
TKDMMYLDRTAKEMVLYLDELQRPNGLYYHAPDVPYYWGRGNGWIAAGITELLRYLPKNH
KDRPRIMEGYLKMMESLRNYQNINGLWNQLIDQTDCWTETSGSAMFTFAFIMGVKHGWLD
AKKYTPAARKAWMALVSYINTNNEVTEVCIGTDRKNDKQYYYDRKRCVGDYHGQAPYLWC
VSALLEK

Enzyme Prediction     

No EC number prediction in MGYG000003367_01006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	364	1.1e-72	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.82e-50	63	360	33	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.70e-43	64	358	41	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68157.1	1.37e-204	12	367	13	368
ALJ39793.1	1.74e-201	15	366	11	362
QUT40891.1	2.24e-201	15	366	18	369
QUT73038.1	2.24e-201	15	366	18	369
QDH53377.1	5.97e-201	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	3.12e-30	162	359	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	5.47e-29	67	364	49	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.35e-28	67	364	39	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	6.06e-21	58	358	24	352	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
5NOA_A	1.01e-20	144	315	143	324	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.00e-28	67	364	49	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	3.96e-20	67	328	100	378	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	3.67e-16	133	317	139	332	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.65e-15	200	315	219	329	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999183	0.000164	0.000137	0.000133	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_01006.