CAZyme Information: MGYG000003367_01526

Basic Information

• Species: Bacteroides sp007896885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp007896885
• CAZyme ID: MGYG000003367_01526
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	MGYG000003367_43|CGC1	29883.38	8.9245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003367	3747359	MAG	United States	North America

• Gene Location: Start: 39450; End: 40232 Strand: -

Full Sequence      

MKRCFILSFLLLLGVLKLNMLFAQDPDPLPSPASPEKAKVYRIPEVDSVPSGYSLNDENI
LDFCGQLIDLNIHERRRKLGRELAVLSRYSSKLVQRANFYFPRIEPILSENGIPDDFKYL
MVIESGLDPYACSGKGAAGLWQFMKGTAGDYGLNVTDGIDERFHIEKATQAACQYLKNAY
RRFGNWVAVAQSYNIGPERVATEMARQRVDDPLELRLVEETNRYTYRIFAAKIIFTHPKN
FGIDENLLYYKKIRAYSRFR

Enzyme Prediction     

No EC number prediction in MGYG000003367_01526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	100	231	2.7e-23	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.05e-53	108	233	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	9.52e-23	114	200	12	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	9.45e-16	120	243	124	252	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	1.03e-15	120	231	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.97e-11	96	260	135	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42036.1	3.66e-123	1	257	1	257
QUT85999.1	6.48e-71	61	242	61	245
QJR79260.1	6.48e-71	61	242	61	245
AND21743.1	6.48e-71	61	242	61	245
QJR57517.1	6.48e-71	61	242	61	245

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.29e-17	57	243	56	249	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.29e-17	57	243	56	249	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000455	0.998783	0.000207	0.000192	0.000187	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003367_01526.