CAZyme Information: MGYG000003369_00717

Basic Information

• Species: Anaerococcus sp900258475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus sp900258475
• CAZyme ID: MGYG000003369_00717
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1094	MGYG000003369_32|CGC1	126104.73	6.6009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003369	1844507	MAG	United States	North America

• Gene Location: Start: 5732; End: 9016 Strand: +

Full Sequence      

MKTKHFTEKIDTSRRLYKLNKNWRHALGEAPGFYKPYFDDSSWEIVDIPHDYSINRNYSR
AGEAQSAYKLAGIGLYRKSFYIGNKKQVLIAFDGIYCDCDIYLNGKYLANHHHGYAPFMI
DLTDFLYYDRENILAIRVDNPIPTSRWYSGSGIFRDVDLILTDDIYFKEIKINDIGLEEN
KADVTLKIKANLENKSKNQEKIRISHKILYDNKIIKTFKSENFTINPTDDLNIESNFQIK
YPKLWQPDSPHLYKIQSTIEKNGQILDRVTNDYGFRYLSASSQSGLKLNGNPIKLKAVCL
HHDQGALGAADHYRAILRQVLIMKDMGANAIRVTHNPASSKLIDIANKYGILLIEEIFDG
WIMDKNNDYNDYSRFFDKKIGPSHLLNSKEEMTWAEYDLKETLRRDYNSPAIIAYSLGNE
LMCGTNQSKRKDYPKIAKNLLDRAREIDQKRFITIGDNSLRDGYDPILVEIEEEITKSKG
LVGLNYCYNKKYDQIHKDYPNWILWQSESASSINSRASYDRLGGDLREDFMLTSFDDSKV
AWGNLASEARYDVINRDFIMGEAVRTGFDYLGEPTPYNAIARGYPYGEKAPRSSFFGIVD
TAGFAKDSYYFYRAQWNDKDTTTHLLPSWNDKELGSFTENVPLTVYTNAWAVELIFTDSK
GKRQSLGKKYMEEVKTPAGFTYKKLKGESGHKALYMTWYLPYEKGKIEAISYDKCGNIIE
NTVGRSKIWTPGYETFIKLKSFYPYLKDGNEKINYIAIDLVDKNGQIKTDTRDEIFVEVS
KNARLLALDSGLATDHEPFKTKHKKAYGGRLLAIIEAIDAGPITVKAYGANLQESQIEIE
SRGEFKKGQSVEYDKYFMTFDKETYPEKFTQGSKTWDLIETNTNDGFATYKSIDQDIPIN
LYIKNLKKDSRLMAYDMGIFEGEDPVLPKSLPLIDEEGKIIYHGKDIEYDNFDEDDFIKN
DSCLIKSSLDLCGKTYHGKVKINKLVEKYRLDAYIEDFALRKAKNESEAFFAFDTQQVFG
QIEIISTDSLEDISFLIGESEDEDSFKVIRPEKTIKESCKTTYDFGNFAATFIKIRGRLE
NIDKIRLRSLRIKL

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	614	1.9e-96	0.6303191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.42e-62	12	707	8	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.68e-27	74	453	111	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	3.76e-27	10	455	5	447	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	1.48e-21	755	838	19	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam02837	Glyco_hydro_2_N	8.90e-18	16	160	1	166	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV29629.1	0.0	1	1094	1	1091
ASM70369.1	2.75e-235	13	1076	83	1229
QRT48501.1	3.97e-223	12	973	60	1056
QCX47063.1	4.29e-221	11	1075	66	1214
SQH28248.1	2.31e-220	11	1075	66	1214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QUB_B	5.55e-205	22	839	15	851	Truncatedbeta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	6.66e-205	6	839	21	874	Truncatedbeta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]
5DMY_A	2.61e-203	6	839	27	880	Beta-galactosidase- construct 33-930 [Bifidobacterium bifidum],5DMY_B Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum],5DMY_C Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum]
7NIT_A	1.40e-201	6	940	21	993	ChainA, Beta-galactosidase [Bifidobacterium bifidum],7NIT_B Chain B, Beta-galactosidase [Bifidobacterium bifidum],7NIT_C Chain C, Beta-galactosidase [Bifidobacterium bifidum],7NIT_D Chain D, Beta-galactosidase [Bifidobacterium bifidum],7NIT_E Chain E, Beta-galactosidase [Bifidobacterium bifidum],7NIT_F Chain F, Beta-galactosidase [Bifidobacterium bifidum]
4YPJ_A	5.26e-158	11	839	5	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	4.78e-107	20	816	48	822	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	5.72e-77	20	795	52	772	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	2.11e-47	6	806	43	794	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P26257	5.55e-34	14	486	2	454	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
P77989	1.51e-33	14	664	3	584	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003369_00717.